Clone BO33167 Report

Search the DGRC for BO33167

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:331
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptCG34134-RA
Protein status:BO33167.pep: Imported from assembly
Sequenced Size:391

Clone Sequence Records

BO33167.complete Sequence

391 bp assembled on 2012-08-22

GenBank Submission: KX799490

> BO33167.complete
GAAGTTATCAGTCGACATGCGCGCTCCAGAGTGGATGAGCAATGAAATGG
CGCGCCTCACATCAAGGCTCGAGCGCTACAAGCCAACGGGCAGTGGATAT
AATCGCATCCAGTCGATTCGACTGTCCAAAAGCGTTACCCAAATGCTGAA
CAATCCAATGCCTCCGGCACCAGCCGCTGCCACCGCCAGATCGCAGCCAG
AAAGCTCCTTCACAACGCCGCGACGGCGCGGTGTCCTTAGTCGCACTCAA
TCGGAATGGGAGGAGGTGTATCCTGTCGTCAAGTTCAATCGTCAAGGGAG
CAGCGAGAGCGACATAAGTGAGGATAACGAACTGAGGTTCACCCACTATA
GAAACTGTGCCACGCGTATTCCTGCAAGCTTTCTAGACCAT

BO33167.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34134-RA 360 CG34134-PA 1..357 17..373 1785 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG34134-RA 485 CG34134-RA 41..398 16..373 1790 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8190384..8190741 373..16 1790 100 Minus
Blast to na_te.dros performed on 2014-11-28 12:18:48 has no hits.

BO33167.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-08-22 17:08:05 Download gff for BO33167.complete
Subject Subject Range Query Range Percent Splice Strand
CG34134-RA 42..398 17..375 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:41:19 Download gff for BO33167.complete
Subject Subject Range Query Range Percent Splice Strand
CG34134-RA 42..398 17..375 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:01:40 Download gff for BO33167.complete
Subject Subject Range Query Range Percent Splice Strand
CG34134-RA 42..398 17..375 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 13:01:40 Download gff for BO33167.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8190381..8190740 17..375 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:41:19 Download gff for BO33167.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8190381..8190740 17..375 99   Minus

BO33167.pep Sequence

Translation from 16 to 391

> BO33167.pep
MRAPEWMSNEMARLTSRLERYKPTGSGYNRIQSIRLSKSVTQMLNNPMPP
APAAATARSQPESSFTTPRRRGVLSRTQSEWEEVYPVVKFNRQGSSESDI
SEDNELRFTHYRNCATRIPASFLDH

BO33167.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34134-PA 119 CG34134-PA 1..119 1..119 620 100 Plus