BO33321.complete Sequence
595 bp assembled on 2012-08-22
GenBank Submission: KX799178
> BO33321.complete
GAAGTTATCAGTCGACATGGGCAAGAAGAATTCAAAATTGAAGCAGGACA
CCATCGATCGGCTGACAACAGACACATACTTCACTGAAAAGGAAATTCGT
CAATGGCACAAGGGCTTTCTCAAAGACTGTCCGAATGGCTTGCTGACCGA
ACAAGGCTTCATCAAAATCTATAAGCAATTCTTCCCCGACGGAGACCCCA
GCAAATTTGCCTCCCTGGTCTTTCGTGTCTTCGATGAGAATAATGATGGC
GCCATTGAGTTCGAGGAGTTCATTCGGGCCCTGTCCATCACATCACGCGG
AAATCTGGACGAGAAGCTGCACTGGGCTTTCCGTTTGTACGACGTGGACA
ACGATGGCTATATAACACGCGAGGAGATGTACAACATAGTGGACGCCATC
TACCAGATGGTAGGACAACAGCCGCAGACGGAGGACGAGAACACGCCGCA
GAAGCGGGTGGACAAGATCTTCGATCAGATGGACAAGAACCACGACGATC
GACTGACGCTGGAGGAGTTCCGCGAGGGCAGTAAAGCTGATCCACGTATA
GTGCAGGCGTTAAGTTTAGGTGGTGATGCAAGCTTTCTAGACCAT
BO33321.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:25:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Frq2-RD | 564 | CG5907-PD | 1..561 | 17..577 | 2805 | 100 | Plus |
Frq2-RC | 564 | CG5907-PC | 1..561 | 17..577 | 2805 | 100 | Plus |
Frq2-RB | 564 | CG5907-PB | 1..561 | 17..577 | 2805 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:25:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Frq2-RD | 4161 | CG5907-RD | 649..1210 | 16..577 | 2810 | 100 | Plus |
Frq2-RC | 4028 | CG5907-RC | 516..1077 | 16..577 | 2810 | 100 | Plus |
Frq2-RB | 2322 | CG5907-RB | 379..940 | 16..577 | 2810 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:24:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 18201292..18201456 | 413..577 | 825 | 100 | Plus |
X | 23542271 | X | 18169989..18170151 | 413..575 | 485 | 86.5 | Plus |
X | 23542271 | X | 18200655..18200745 | 155..245 | 455 | 100 | Plus |
X | 23542271 | X | 18201143..18201232 | 324..413 | 450 | 100 | Plus |
X | 23542271 | X | 18200830..18200909 | 245..324 | 400 | 100 | Plus |
X | 23542271 | X | 18192499..18192563 | 16..80 | 325 | 100 | Plus |
X | 23542271 | X | 18169696..18169783 | 324..411 | 290 | 88.6 | Plus |
X | 23542271 | X | 18199773..18199823 | 105..155 | 255 | 100 | Plus |
X | 23542271 | X | 18168403..18168493 | 155..245 | 215 | 82.4 | Plus |
Blast to na_te.dros performed on 2014-11-28 12:24:59 has no hits.
BO33321.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-08-22 17:08:24 Download gff for
BO33321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Frq2-RC | 515..1075 | 17..579 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:42:45 Download gff for
BO33321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Frq2-RB | 380..940 | 17..579 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:03:39 Download gff for
BO33321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Frq2-RB | 380..940 | 17..579 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 13:03:39 Download gff for
BO33321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 18192500..18192563 | 17..80 | 100 | -> | Plus |
X | 18199124..18199148 | 81..105 | 100 | -> | Plus |
X | 18199774..18199822 | 106..154 | 100 | -> | Plus |
X | 18200655..18200744 | 155..244 | 100 | -> | Plus |
X | 18200830..18200908 | 245..323 | 100 | -> | Plus |
X | 18201143..18201231 | 324..412 | 100 | -> | Plus |
X | 18201292..18201456 | 413..579 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:42:45 Download gff for
BO33321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 18093807..18093855 | 106..154 | 100 | -> | Plus |
arm_X | 18094688..18094777 | 155..244 | 100 | -> | Plus |
arm_X | 18094863..18094941 | 245..323 | 100 | -> | Plus |
arm_X | 18095176..18095264 | 324..412 | 100 | -> | Plus |
arm_X | 18095325..18095489 | 413..579 | 98 | | Plus |
arm_X | 18086533..18086596 | 17..80 | 100 | -> | Plus |
arm_X | 18093157..18093181 | 81..105 | 100 | -> | Plus |
BO33321.pep Sequence
Translation from 16 to 595
> BO33321.pep
MGKKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIK
IYKQFFPDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEK
LHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTEDENTPQKRVDK
IFDQMDKNHDDRLTLEEFREGSKADPRIVQALSLGGDASFLDH
BO33321.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:24:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Frq2-PD | 187 | CG5907-PD | 1..187 | 1..187 | 992 | 100 | Plus |
Frq2-PC | 187 | CG5907-PC | 1..187 | 1..187 | 992 | 100 | Plus |
Frq2-PB | 187 | CG5907-PB | 1..187 | 1..187 | 992 | 100 | Plus |
Frq2-PA | 187 | CG5907-PA | 1..187 | 1..187 | 992 | 100 | Plus |
Frq1-PE | 187 | CG5744-PE | 1..186 | 1..186 | 946 | 95.2 | Plus |