BO33328.complete Sequence
415 bp assembled on 2012-08-22
GenBank Submission: KX799089
> BO33328.complete
GAAGTTATCAGTCGACATGGAACCGTCAGCCTGCGAAGATCTCAAGGCCT
TCGAGCGGCGCCTCACCGAAGTGGTTTCATCGTACCGTCCCTCGACGTTC
CGCTGGCGCATTGTCCTTTCCGCCATGTCCATGTGCACCGCCATCAGCGC
CTGGTACTGGCTACGCGATCCGCGCACCACCGTTGTACCGCTAACGGAGT
CCCTCTGGATTCATCCCGTCTTCACAGTCGCCACCCTAACATTGGTCGTC
CTGTTCATCCTGGGCATACAGAAACTAGTCATAGCTCCGCAAATAATTAC
ATCGAGAACGCGAATGGTACTGGGAGACTTTAATATGAGCTGTGACGACA
CGGGGAAGCTGATACTCAAGCCGCGGCAAAGTAACAACAACAGTACAGCA
AGCTTTCTAGACCAT
BO33328.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:26:01
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG8009-RA | 384 | CG8009-PA | 1..381 | 17..397 | 1905 | 100 | Plus |
| CG8009-RB | 396 | CG8009-PB | 1..393 | 17..397 | 1750 | 96.9 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:26:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG8009-RA | 804 | CG8009-RA | 159..539 | 17..397 | 1905 | 100 | Plus |
| CG8009-RB | 863 | CG8009-RB | 159..551 | 17..397 | 1750 | 96.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:25:59
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 10639214..10639366 | 245..397 | 765 | 100 | Plus |
| 3L | 28110227 | 3L | 10638566..10638700 | 111..245 | 675 | 100 | Plus |
| 3L | 28110227 | 3L | 10638421..10638494 | 37..110 | 370 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 12:26:00
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| gypsy8 | 4955 | gypsy8 GYPSY8 4955bp | 939..977 | 100..63 | 111 | 79.5 | Minus |
BO33328.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-08-22 17:08:27 Download gff for
BO33328.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8009-RA | 152..532 | 17..399 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:42:57 Download gff for
BO33328.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8009-RA | 159..539 | 17..399 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:04:00 Download gff for
BO33328.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8009-RA | 159..539 | 17..399 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 13:04:00 Download gff for
BO33328.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 10639215..10639366 | 246..399 | 98 | | Plus |
| 3L | 10638304..10638325 | 17..38 | 100 | -> | Plus |
| 3L | 10638423..10638494 | 39..110 | 100 | -> | Plus |
| 3L | 10638566..10638700 | 111..245 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:42:57 Download gff for
BO33328.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 10631404..10631425 | 17..38 | 100 | -> | Plus |
| arm_3L | 10631523..10631594 | 39..110 | 100 | -> | Plus |
| arm_3L | 10631666..10631800 | 111..245 | 100 | -> | Plus |
| arm_3L | 10632315..10632466 | 246..399 | 98 | | Plus |
BO33328.pep Sequence
Translation from 16 to 415
> BO33328.pep
MEPSACEDLKAFERRLTEVVSSYRPSTFRWRIVLSAMSMCTAISAWYWLR
DPRTTVVPLTESLWIHPVFTVATLTLVVLFILGIQKLVIAPQIITSRTRM
VLGDFNMSCDDTGKLILKPRQSNNNSTASFLDH
BO33328.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:24:06
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG8009-PA | 127 | CG8009-PA | 1..127 | 1..127 | 656 | 100 | Plus |
| CG8009-PB | 131 | CG8009-PB | 1..131 | 1..127 | 640 | 96.2 | Plus |
| CG41106-PA | 123 | CG41106-PA | 1..122 | 1..122 | 205 | 37.7 | Plus |
