Clone BO33902 Report

Search the DGRC for BO33902

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:339
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptLysB-RA
Protein status:BO33902.pep: Imported from assembly
Sequenced Size:454

Clone Sequence Records

BO33902.complete Sequence

454 bp assembled on 2013-04-19

GenBank Submission: KX795713

> BO33902.complete
GAAGTTATCAGTCGACATGAAGGCTTTCATCGTTCTGGTTGCCCTGGCTC
TGGCCGCTCCTGCTCTTGGTCGCACCATGGACCGTTGCTCCCTGGCCCGG
GAGATGTCCAACCTGGGCGTTCCTCGTGACCAATTGGCTCGTTGGGCCTG
CATTGCCGAGCACGAGTCCTCCTACCGCACCGGAGTGGTTGGTCCCGAGA
ACTACAACGGCTCCAACGACTACGGAATCTTCCAGATCAACGACTACTAC
TGGTGCGCTCCTCCCAGCGGTCGCTTCTCCTACAATGAGTGCGGGTTGAG
CTGCAATGCCCTCTTGACCGACGACATCACCCACTCCGTCCGTTGTGCCC
AGAAGGTCCTCAGCCAGCAGGGATGGTCCGCCTGGTCCACCTGGCACTAC
TGCAGCGGATGGTTGCCGTCCATCGATGACTGCTTCGCAAGCTTTCTAGA
CCAT

BO33902.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
LysB-RB 423 CG1179-PB 1..420 17..436 2100 100 Plus
LysB-RA 423 CG1179-PA 1..420 17..436 2100 100 Plus
LysE-RA 423 CG1180-PA 1..420 17..436 1875 96.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:20:28
Subject Length Description Subject Range Query Range Score Percent Strand
LysB-RB 611 CG1179-RB 22..443 15..436 2110 100 Plus
LysB-RA 486 CG1179-RA 22..443 15..436 2110 100 Plus
LysE-RA 580 CG1180-RA 126..545 17..436 1875 96.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1207392..1207813 15..436 2110 100 Plus
3L 28110227 3L 1212952..1213371 17..436 1875 96.4 Plus
3L 28110227 3L 1210758..1211178 436..16 1865 96.2 Minus
3L 28110227 3L 1227770..1228191 15..436 975 83.1 Plus
3L 28110227 3L 1210484..1210726 16..258 900 91.4 Plus
3L 28110227 3L 1218286..1218607 410..89 680 80.7 Minus
3L 28110227 3L 1194874..1195241 435..68 625 78 Minus
Blast to na_te.dros performed on 2014-11-28 13:20:26 has no hits.

BO33902.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:31:08 Download gff for BO33902.complete
Subject Subject Range Query Range Percent Splice Strand
LysB-RA 24..443 17..438 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:04:01 Download gff for BO33902.complete
Subject Subject Range Query Range Percent Splice Strand
LysB-RA 24..443 17..438 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:26:29 Download gff for BO33902.complete
Subject Subject Range Query Range Percent Splice Strand
LysB-RA 24..443 17..438 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:26:29 Download gff for BO33902.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1207394..1207813 17..438 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:04:01 Download gff for BO33902.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1207394..1207813 17..438 99   Plus

BO33902.pep Sequence

Translation from 16 to 454

> BO33902.pep
MKAFIVLVALALAAPALGRTMDRCSLAREMSNLGVPRDQLARWACIAEHE
SSYRTGVVGPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALL
TDDITHSVRCAQKVLSQQGWSAWSTWHYCSGWLPSIDDCFASFLDH

BO33902.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
LysB-PB 140 CG1179-PB 1..140 1..140 779 100 Plus
LysB-PA 140 CG1179-PA 1..140 1..140 779 100 Plus
LysD-PA 140 CG9118-PA 1..140 1..140 770 98.6 Plus
LysE-PA 140 CG1180-PA 1..140 1..140 762 97.1 Plus
LysC-PA 140 CG9111-PA 1..140 1..140 761 97.1 Plus