BO33902.complete Sequence
454 bp assembled on 2013-04-19
GenBank Submission: KX795713
> BO33902.complete
GAAGTTATCAGTCGACATGAAGGCTTTCATCGTTCTGGTTGCCCTGGCTC
TGGCCGCTCCTGCTCTTGGTCGCACCATGGACCGTTGCTCCCTGGCCCGG
GAGATGTCCAACCTGGGCGTTCCTCGTGACCAATTGGCTCGTTGGGCCTG
CATTGCCGAGCACGAGTCCTCCTACCGCACCGGAGTGGTTGGTCCCGAGA
ACTACAACGGCTCCAACGACTACGGAATCTTCCAGATCAACGACTACTAC
TGGTGCGCTCCTCCCAGCGGTCGCTTCTCCTACAATGAGTGCGGGTTGAG
CTGCAATGCCCTCTTGACCGACGACATCACCCACTCCGTCCGTTGTGCCC
AGAAGGTCCTCAGCCAGCAGGGATGGTCCGCCTGGTCCACCTGGCACTAC
TGCAGCGGATGGTTGCCGTCCATCGATGACTGCTTCGCAAGCTTTCTAGA
CCAT
BO33902.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:20:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LysB-RB | 423 | CG1179-PB | 1..420 | 17..436 | 2100 | 100 | Plus |
LysB-RA | 423 | CG1179-PA | 1..420 | 17..436 | 2100 | 100 | Plus |
LysE-RA | 423 | CG1180-PA | 1..420 | 17..436 | 1875 | 96.4 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:20:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LysB-RB | 611 | CG1179-RB | 22..443 | 15..436 | 2110 | 100 | Plus |
LysB-RA | 486 | CG1179-RA | 22..443 | 15..436 | 2110 | 100 | Plus |
LysE-RA | 580 | CG1180-RA | 126..545 | 17..436 | 1875 | 96.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:20:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 1207392..1207813 | 15..436 | 2110 | 100 | Plus |
3L | 28110227 | 3L | 1212952..1213371 | 17..436 | 1875 | 96.4 | Plus |
3L | 28110227 | 3L | 1210758..1211178 | 436..16 | 1865 | 96.2 | Minus |
3L | 28110227 | 3L | 1227770..1228191 | 15..436 | 975 | 83.1 | Plus |
3L | 28110227 | 3L | 1210484..1210726 | 16..258 | 900 | 91.4 | Plus |
3L | 28110227 | 3L | 1218286..1218607 | 410..89 | 680 | 80.7 | Minus |
3L | 28110227 | 3L | 1194874..1195241 | 435..68 | 625 | 78 | Minus |
Blast to na_te.dros performed on 2014-11-28 13:20:26 has no hits.
BO33902.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:31:08 Download gff for
BO33902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LysB-RA | 24..443 | 17..438 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:04:01 Download gff for
BO33902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LysB-RA | 24..443 | 17..438 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:26:29 Download gff for
BO33902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LysB-RA | 24..443 | 17..438 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:26:29 Download gff for
BO33902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 1207394..1207813 | 17..438 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:04:01 Download gff for
BO33902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 1207394..1207813 | 17..438 | 99 | | Plus |
BO33902.pep Sequence
Translation from 16 to 454
> BO33902.pep
MKAFIVLVALALAAPALGRTMDRCSLAREMSNLGVPRDQLARWACIAEHE
SSYRTGVVGPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALL
TDDITHSVRCAQKVLSQQGWSAWSTWHYCSGWLPSIDDCFASFLDH
BO33902.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:09:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LysB-PB | 140 | CG1179-PB | 1..140 | 1..140 | 779 | 100 | Plus |
LysB-PA | 140 | CG1179-PA | 1..140 | 1..140 | 779 | 100 | Plus |
LysD-PA | 140 | CG9118-PA | 1..140 | 1..140 | 770 | 98.6 | Plus |
LysE-PA | 140 | CG1180-PA | 1..140 | 1..140 | 762 | 97.1 | Plus |
LysC-PA | 140 | CG9111-PA | 1..140 | 1..140 | 761 | 97.1 | Plus |