BO33932.complete Sequence
316 bp assembled on 2013-04-19
GenBank Submission: KX796009
> BO33932.complete
GAAGTTATCAGTCGACATGTTCCGCTTGCTGCTGCTGTGGATCACTGTGG
GGCTGGTGGCAGCTCTGGATGAGCGGGAATTCGATCCGCAGGTGGCACCA
CCTCAAAGTTCAGTTCCAAAACCCTTTCAGCTGTGGCGAAGTTTTGCGAG
TCATGTGCGTCTTGTCTTTAGTCGTCTTCAACCTAAGTCACCAACTCCGC
CCACCGTTAGGACCAAAACGGGTATAACTACCACCACTCCCGAACCTGAA
CTGCAGTTCTATGGAGCTCTGAATCCCATATACCAAACAGGGAACTTTGC
AAGCTTTCTAGACCAT
BO33932.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:19:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34223-RA | 285 | CG34223-PA | 1..282 | 17..298 | 1410 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:19:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34223-RA | 285 | CG34223-RA | 1..282 | 17..298 | 1410 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:19:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11236014..11236201 | 111..298 | 940 | 100 | Plus |
2R | 25286936 | 2R | 11235860..11235956 | 17..113 | 485 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 13:19:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6983..7022 | 40..1 | 101 | 72.5 | Minus |
BO33932.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:18:09 Download gff for
BO33932.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34223-RA | 6..282 | 22..300 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:03:33 Download gff for
BO33932.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34223-RA | 6..282 | 22..300 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:26:08 Download gff for
BO33932.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34223-RA | 6..282 | 22..300 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:26:08 Download gff for
BO33932.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11235865..11235956 | 22..113 | 100 | -> | Plus |
2R | 11236017..11236201 | 114..300 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:03:33 Download gff for
BO33932.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7123370..7123461 | 22..113 | 100 | -> | Plus |
arm_2R | 7123522..7123706 | 114..300 | 98 | | Plus |
BO33932.pep Sequence
Translation from 16 to 316
> BO33932.pep
MFRLLLLWITVGLVAALDEREFDPQVAPPQSSVPKPFQLWRSFASHVRLV
FSRLQPKSPTPPTVRTKTGITTTTPEPELQFYGALNPIYQTGNFASFLDH
BO33932.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:09:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34223-PA | 94 | CG34223-PA | 1..94 | 1..94 | 496 | 100 | Plus |