Clone BO33932 Report

Search the DGRC for BO33932

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:339
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG34223-RA
Protein status:BO33932.pep: Imported from assembly
Sequenced Size:316

Clone Sequence Records

BO33932.complete Sequence

316 bp assembled on 2013-04-19

GenBank Submission: KX796009

> BO33932.complete
GAAGTTATCAGTCGACATGTTCCGCTTGCTGCTGCTGTGGATCACTGTGG
GGCTGGTGGCAGCTCTGGATGAGCGGGAATTCGATCCGCAGGTGGCACCA
CCTCAAAGTTCAGTTCCAAAACCCTTTCAGCTGTGGCGAAGTTTTGCGAG
TCATGTGCGTCTTGTCTTTAGTCGTCTTCAACCTAAGTCACCAACTCCGC
CCACCGTTAGGACCAAAACGGGTATAACTACCACCACTCCCGAACCTGAA
CTGCAGTTCTATGGAGCTCTGAATCCCATATACCAAACAGGGAACTTTGC
AAGCTTTCTAGACCAT

BO33932.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG34223-RA 285 CG34223-PA 1..282 17..298 1410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG34223-RA 285 CG34223-RA 1..282 17..298 1410 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:19:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11236014..11236201 111..298 940 100 Plus
2R 25286936 2R 11235860..11235956 17..113 485 100 Plus
Blast to na_te.dros performed 2014-11-28 13:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6983..7022 40..1 101 72.5 Minus

BO33932.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:18:09 Download gff for BO33932.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 6..282 22..300 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:03:33 Download gff for BO33932.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 6..282 22..300 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:26:08 Download gff for BO33932.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 6..282 22..300 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:26:08 Download gff for BO33932.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11235865..11235956 22..113 100 -> Plus
2R 11236017..11236201 114..300 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:03:33 Download gff for BO33932.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7123370..7123461 22..113 100 -> Plus
arm_2R 7123522..7123706 114..300 98   Plus

BO33932.pep Sequence

Translation from 16 to 316

> BO33932.pep
MFRLLLLWITVGLVAALDEREFDPQVAPPQSSVPKPFQLWRSFASHVRLV
FSRLQPKSPTPPTVRTKTGITTTTPEPELQFYGALNPIYQTGNFASFLDH

BO33932.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34223-PA 94 CG34223-PA 1..94 1..94 496 100 Plus