BO33961.complete Sequence
175 bp assembled on 2013-04-22
GenBank Submission: KX794641
> BO33961.complete
GAAGTTATCAGTCGACATGTCCGCCAGCGGTCGTCGCTTCTGTCGCAGCC
GTTGCCAAAGTTGTCATTGTCATCCGTACCAGCAAACGCAGCAGCAAAAG
CAGCAGCAGCAGCAGCAGCAGCAACATCAGGCAGCAGCAGCAGCAGCAAC
TAGCAACGCAAGCTTTCTAGACCAT
BO33961.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:32:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rdh-RA | 144 | CG14975-PA | 1..141 | 17..157 | 705 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:32:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rdh-RA | 440 | CG14975-RA | 76..216 | 17..157 | 705 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:31:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3825524..3825664 | 17..157 | 705 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 13:32:00 has no hits.
BO33961.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-22 17:46:53 Download gff for
BO33961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 1..141 | 17..159 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:07:39 Download gff for
BO33961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 76..216 | 17..159 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:29:08 Download gff for
BO33961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rdh-RA | 76..216 | 17..159 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:29:08 Download gff for
BO33961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3825524..3825664 | 17..159 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:07:39 Download gff for
BO33961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3825524..3825664 | 17..159 | 98 | | Plus |
BO33961.pep Sequence
Translation from 16 to 175
> BO33961.pep
MSASGRRFCRSRCQSCHCHPYQQTQQQKQQQQQQQQHQAAAAAATSNASF
LDH
BO33961.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:13:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rdh-PA | 47 | CG14975-PA | 1..47 | 1..47 | 255 | 100 | Plus |