Clone BO33961 Report

Search the DGRC for BO33961

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:339
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptRdh-RA
Protein status:BO33961.pep: Imported from assembly
Sequenced Size:175

Clone Sequence Records

BO33961.complete Sequence

175 bp assembled on 2013-04-22

GenBank Submission: KX794641

> BO33961.complete
GAAGTTATCAGTCGACATGTCCGCCAGCGGTCGTCGCTTCTGTCGCAGCC
GTTGCCAAAGTTGTCATTGTCATCCGTACCAGCAAACGCAGCAGCAAAAG
CAGCAGCAGCAGCAGCAGCAGCAACATCAGGCAGCAGCAGCAGCAGCAAC
TAGCAACGCAAGCTTTCTAGACCAT

BO33961.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Rdh-RA 144 CG14975-PA 1..141 17..157 705 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Rdh-RA 440 CG14975-RA 76..216 17..157 705 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3825524..3825664 17..157 705 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:32:00 has no hits.

BO33961.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-22 17:46:53 Download gff for BO33961.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 1..141 17..159 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:07:39 Download gff for BO33961.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 76..216 17..159 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:29:08 Download gff for BO33961.complete
Subject Subject Range Query Range Percent Splice Strand
Rdh-RA 76..216 17..159 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:29:08 Download gff for BO33961.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3825524..3825664 17..159 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:07:39 Download gff for BO33961.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3825524..3825664 17..159 98   Plus

BO33961.pep Sequence

Translation from 16 to 175

> BO33961.pep
MSASGRRFCRSRCQSCHCHPYQQTQQQKQQQQQQQQHQAAAAAATSNASF
LDH

BO33961.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Rdh-PA 47 CG14975-PA 1..47 1..47 255 100 Plus