Clone BO33993 Report

Search the DGRC for BO33993

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:339
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptCG11269-RA
Protein status:BO33993.pep: Imported from assembly
Sequenced Size:355

Clone Sequence Records

BO33993.complete Sequence

355 bp assembled on 2013-04-24

GenBank Submission: KX796589

> BO33993.complete
GAAGTTATCAGTCGACATGTTTTGTGGTCGCAAGTGCTGTCTGTTCTGCC
TGTTCATGAGCGCCTGGGGCTTCTTGATGCTGAATCTGCTGGGTATCTTC
TTCTACGTCCAGTCACTGATGCTCCTGGAGTCCCTGCCCTTGCCCCACCA
CTTCCCCAGTCAGGAGGCCTTCAAGGAGCAGGCGGACGAGGCCTACCAGG
ACGTGTCCACACGGTGCTTTGTAGCCGCCGTTTTCTATCTGGGATTCGTC
TTCATTGCGATAGTGGCCATTCGTCGGGATAACAAGAGAAGGAAGCGACT
CTACAAGCGGGGTCCCGGTCACTTGCGATTCCGTCGTGCAAGCTTTCTAG
ACCAT

BO33993.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11269-RA 324 CG11269-PA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG11269-RA 401 CG11269-RA 48..368 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22138942..22139262 17..337 1605 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:32:55 has no hits.

BO33993.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-24 14:12:12 Download gff for BO33993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11269-RA 8..321 24..339 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:07:55 Download gff for BO33993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11269-RA 55..368 24..339 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:29:21 Download gff for BO33993.complete
Subject Subject Range Query Range Percent Splice Strand
CG11269-RA 55..368 24..339 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:29:21 Download gff for BO33993.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22138949..22139262 24..339 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:07:55 Download gff for BO33993.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18026454..18026767 24..339 99   Plus

BO33993.pep Sequence

Translation from 16 to 355

> BO33993.pep
MFCGRKCCLFCLFMSAWGFLMLNLLGIFFYVQSLMLLESLPLPHHFPSQE
AFKEQADEAYQDVSTRCFVAAVFYLGFVFIAIVAIRRDNKRRKRLYKRGP
GHLRFRRASFLDH

BO33993.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG11269-PA 107 CG11269-PA 1..107 1..107 573 100 Plus
CG40127-PA 95 CG40127-PA 4..76 3..75 156 41.1 Plus
CG40127-PB 95 CG40127-PB 4..76 3..75 156 41.1 Plus