BO34044.complete Sequence
280 bp assembled on 2013-04-19
GenBank Submission: KX794806
> BO34044.complete
GAAGTTATCAGTCGACATGGGTCGTCGCAAGTCCAAACGCAAAGGAGCCC
CAAGAAAGAAAAATATTCAGCCGCTGCCCATTCTTTTCGATTGTCCATTC
TGCAATCACAAGCAGTCATGTGAAGCGAAACTAGATAAGGCGAAAAAAAT
AGGAAGAATTACCTGTACCGTGTGCCAAGAATTTTTTCAAACACATATAA
ACTATCTCACGGAGGCAATTGATGTGTTCAACGATTGGATTGATGCTTGC
GAGGAGGAGAACGCAAGCTTTCTAGACCAT
BO34044.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:22:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6244-RA | 249 | CG6244-PA | 1..246 | 17..262 | 1230 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:22:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6244-RA | 509 | CG6244-RA | 96..342 | 16..262 | 1235 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:22:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15808587..15808716 | 133..262 | 650 | 100 | Plus |
3L | 28110227 | 3L | 15808417..15808533 | 16..132 | 585 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 13:22:02 has no hits.
BO34044.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:53:02 Download gff for
BO34044.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6244-RA | 1..246 | 17..264 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:04:49 Download gff for
BO34044.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6244-RA | 97..342 | 17..264 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:27:02 Download gff for
BO34044.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6244-RA | 97..342 | 17..264 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:27:02 Download gff for
BO34044.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15808418..15808533 | 17..132 | 100 | -> | Plus |
3L | 15808587..15808716 | 133..264 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:04:49 Download gff for
BO34044.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15801518..15801633 | 17..132 | 100 | -> | Plus |
arm_3L | 15801687..15801816 | 133..264 | 98 | | Plus |
BO34044.pep Sequence
Translation from 16 to 280
> BO34044.pep
MGRRKSKRKGAPRKKNIQPLPILFDCPFCNHKQSCEAKLDKAKKIGRITC
TVCQEFFQTHINYLTEAIDVFNDWIDACEEENASFLDH
BO34044.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:10:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6244-PA | 82 | CG6244-PA | 1..82 | 1..82 | 454 | 100 | Plus |
CG40228-PD | 82 | CG40228-PD | 1..82 | 1..82 | 306 | 63.4 | Plus |
CG40228-PC | 82 | CG40228-PC | 1..82 | 1..82 | 306 | 63.4 | Plus |
CG40228-PE | 77 | CG40228-PE | 1..77 | 1..82 | 269 | 59.8 | Plus |
CG40228-PF | 43 | CG40228-PF | 1..34 | 1..34 | 133 | 67.6 | Plus |