Clone BO34044 Report

Search the DGRC for BO34044

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:340
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG6244-RA
Protein status:BO34044.pep: Imported from assembly
Sequenced Size:280

Clone Sequence Records

BO34044.complete Sequence

280 bp assembled on 2013-04-19

GenBank Submission: KX794806

> BO34044.complete
GAAGTTATCAGTCGACATGGGTCGTCGCAAGTCCAAACGCAAAGGAGCCC
CAAGAAAGAAAAATATTCAGCCGCTGCCCATTCTTTTCGATTGTCCATTC
TGCAATCACAAGCAGTCATGTGAAGCGAAACTAGATAAGGCGAAAAAAAT
AGGAAGAATTACCTGTACCGTGTGCCAAGAATTTTTTCAAACACATATAA
ACTATCTCACGGAGGCAATTGATGTGTTCAACGATTGGATTGATGCTTGC
GAGGAGGAGAACGCAAGCTTTCTAGACCAT

BO34044.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG6244-RA 249 CG6244-PA 1..246 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG6244-RA 509 CG6244-RA 96..342 16..262 1235 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15808587..15808716 133..262 650 100 Plus
3L 28110227 3L 15808417..15808533 16..132 585 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:22:02 has no hits.

BO34044.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:53:02 Download gff for BO34044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 1..246 17..264 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:04:49 Download gff for BO34044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 97..342 17..264 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:27:02 Download gff for BO34044.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 97..342 17..264 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:27:02 Download gff for BO34044.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15808418..15808533 17..132 100 -> Plus
3L 15808587..15808716 133..264 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:04:49 Download gff for BO34044.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15801518..15801633 17..132 100 -> Plus
arm_3L 15801687..15801816 133..264 98   Plus

BO34044.pep Sequence

Translation from 16 to 280

> BO34044.pep
MGRRKSKRKGAPRKKNIQPLPILFDCPFCNHKQSCEAKLDKAKKIGRITC
TVCQEFFQTHINYLTEAIDVFNDWIDACEEENASFLDH

BO34044.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG6244-PA 82 CG6244-PA 1..82 1..82 454 100 Plus
CG40228-PD 82 CG40228-PD 1..82 1..82 306 63.4 Plus
CG40228-PC 82 CG40228-PC 1..82 1..82 306 63.4 Plus
CG40228-PE 77 CG40228-PE 1..77 1..82 269 59.8 Plus
CG40228-PF 43 CG40228-PF 1..34 1..34 133 67.6 Plus