Clone BO34062 Report

Search the DGRC for BO34062

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:340
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG34052-RA
Protein status:BO34062.pep: Imported from assembly
Sequenced Size:187

Clone Sequence Records

BO34062.complete Sequence

187 bp assembled on 2013-04-19

GenBank Submission: KX795705

> BO34062.complete
GAAGTTATCAGTCGACATGGGAGTTGCTACCAAAATCTTTCGTTCGCACG
TTCAAGGCAGCAAAAAAGCAAAAGCAACAGCCACATCAAGAAGCGCAACA
AGAAGGCCAAGAACAGTACGGTACAGTAAGGACTGCCTGTGCGGAATGTT
GTGTAAAAATAAATACGCCGCAAGCTTTCTAGACCAT

BO34062.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 13:21:08 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 13:21:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2322125..2322265 156..16 705 100 Minus
Blast to na_te.dros performed 2014-11-28 13:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
X-element 4740 X-element ROXELEMENT 4740bp 1540..1582 58..98 110 79.1 Plus

BO34062.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:40:15 Download gff for BO34062.complete
Subject Subject Range Query Range Percent Splice Strand
CG34052-RA 1..153 17..171 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:26:42 Download gff for BO34062.complete
Subject Subject Range Query Range Percent Splice Strand
X 2322125..2322264 17..156 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:26:42 Download gff for BO34062.complete
Subject Subject Range Query Range Percent Splice Strand
X 2322125..2322264 17..156 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:04:22 Download gff for BO34062.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2216158..2216297 17..156 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:04:22 Download gff for BO34062.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2216158..2216297 17..156 100   Minus

BO34062.pep Sequence

Translation from 16 to 187

> BO34062.pep
MGVATKIFRSHVQGSKKAKATATSRSATRRPRTVRYSKDCLCGMLCKNKY
AASFLDH
Sequence BO34062.pep has no blast hits.