Clone BO34064 Report

Search the DGRC for BO34064

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:340
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG4982-RA
Protein status:BO34064.pep: Imported from assembly
Sequenced Size:373

Clone Sequence Records

BO34064.complete Sequence

373 bp assembled on 2013-04-19

GenBank Submission: KX794587

> BO34064.complete
GAAGTTATCAGTCGACATGTTCAAAGTTGTGTTCCTTTTGTGCGGAGTAT
TCGCTGTCCTGATCCAGGCTCGCCCCAGCTACTTGCCCAGCTATGAGCAC
GTGGAATATGCTCCCAGTGTCGTAGGATACGAGAGTTATGCCCTTCCAGC
CGCCGTCTCACACCAGAGTTCCACAGTGGTGCACGAGAAGCGTCCCTACT
GGCGCCCCATTGTGGATCACACGCCCATCCTGAAGGCAGCCTATGCTCCA
GCTACTTCGATCTCGTATGCCCCACTTGGATACGCGGGCAACAGTGCGGG
ATGGTACGAGCCGGGAATCTGGGGAGTATCCAGTTACCCCAGCATTTATC
TGAAGGCAAGCTTTCTAGACCAT

BO34064.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG4982-RA 342 CG4982-PA 1..339 17..355 1695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG4982-RA 512 CG4982-RA 32..370 17..355 1695 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16301559..16301885 29..355 1635 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:21:11 has no hits.

BO34064.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:40:24 Download gff for BO34064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4982-RA 20..353 22..357 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:04:22 Download gff for BO34064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4982-RA 37..370 22..357 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:26:43 Download gff for BO34064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4982-RA 37..370 22..357 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:26:43 Download gff for BO34064.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16301554..16301885 22..357 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:04:22 Download gff for BO34064.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16294654..16294985 22..357 98   Plus

BO34064.pep Sequence

Translation from 16 to 373

> BO34064.pep
MFKVVFLLCGVFAVLIQARPSYLPSYEHVEYAPSVVGYESYALPAAVSHQ
SSTVVHEKRPYWRPIVDHTPILKAAYAPATSISYAPLGYAGNSAGWYEPG
IWGVSSYPSIYLKASFLDH

BO34064.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG4982-PA 113 CG4982-PA 1..113 1..113 605 100 Plus