Clone BO34095 Report

Search the DGRC for BO34095

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:340
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG42765-RA
Protein status:BO34095.pep: Imported from assembly
Sequenced Size:223

Clone Sequence Records

BO34095.complete Sequence

223 bp assembled on 2013-04-19

GenBank Submission: KX793861

> BO34095.complete
GAAGTTATCAGTCGACATGCGGTGCCGGCTAATACGAAATGCAAATGATT
GCAAAGTGTATGCAATTTGGACACTACCCATTAAATTAAATATAAACACT
TTGATATATCCATGGAAATCTAGAAGCTTCAAGCATGCGAATGTGATTTC
TATTTATGAGCACACAAGTTGTGTGTCTGGGTTCATAAATTTTCCAGCTT
CCAATGCAAGCTTTCTAGACCAT

BO34095.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 13:21:34 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 13:21:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26325038..26325227 205..16 950 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:21:33 has no hits.

BO34095.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-04-19 17:45:58 Download gff for BO34095.complete
Subject Subject Range Query Range Percent Splice Strand
CG42765-RA 50..238 17..207 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:04:33 Download gff for BO34095.complete
Subject Subject Range Query Range Percent Splice Strand
CG42765-RA 50..238 17..207 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:26:51 Download gff for BO34095.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26325035..26325226 17..207 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:26:51 Download gff for BO34095.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26325035..26325226 17..207 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:04:33 Download gff for BO34095.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22150757..22150948 17..207 98   Minus

BO34095.pep Sequence

Translation from 16 to 223

> BO34095.pep
MRCRLIRNANDCKVYAIWTLPIKLNINTLIYPWKSRSFKHANVISIYEHT
SCVSGFINFPASNASFLDH
Sequence BO34095.pep has no blast hits.