Clone BO34102 Report

Search the DGRC for BO34102

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:341
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG4686-RA
Protein status:BO34102.pep: Imported from assembly
Sequenced Size:577

Clone Sequence Records

BO34102.complete Sequence

577 bp assembled on 2013-05-14

GenBank Submission: KX794584

> BO34102.complete
GAAGTTATCAGTCGACATGTCAGTCGCTGACACCATTGAATACGTGACCC
TGGGCAATCCTGTCAGCAAGATGGTAGCCTCGTCCGCATCCGCCCTGCTC
CGCACGCTTGGTCTGCGTCCCAAGAAGGTGCCGGTGCAGGAGACGAGTAT
GGCGGTGCTCCCTGCCGCCCACAGCTACGCGCATTCACACGGATCACTCT
ATCGACTGGCCGGCTGCCATTACCACTTCATTCGGCTGGCCGGGATCGTC
GGCGCGTCGGCCATCTTTATGGGCGCCTACTGCAAGTACGTCCTGAAGGA
CGTCAGCGATCCCAAGGAGCAGGTGGACTCGCAGGCCTTTGCTGATGTGG
CCAATCGCATCCACTTTCTGCACTCCTTTGCCATGATGGCCATGCCTCTG
GCCCACTATCCCGTATTCACTGGCACTTTGATGATTACGGGCATGATGCT
TTTCAGCGGCTGCATGTACTACCGCGCTTTGACTGGCGAGAAGCGTCTGC
AACCGTACGCGACCGTCGGAGGATTCTGCCTGATGGCCGCGTGGCTGTCG
CTGGTCCTGGCAAGCTTTCTAGACCAT

BO34102.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG4686-RB 546 CG4686-PB 1..543 17..559 2715 100 Plus
CG4686-RA 546 CG4686-PA 1..543 17..559 2715 100 Plus
CG42395-RD 540 CG42395-PD 159..537 181..559 665 78.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG4686-RB 933 CG4686-RB 76..618 17..559 2715 100 Plus
CG4686-RA 1195 CG4686-RA 338..880 17..559 2715 100 Plus
CG4562-RC 6512 CG4562-RC 5375..5515 559..419 705 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19864989..19865297 110..418 1545 100 Plus
3R 32079331 3R 19866414..19866554 419..559 705 100 Plus
X 23542271 X 9575326..9575704 559..181 665 78.4 Minus
3R 32079331 3R 19864833..19864926 17..110 470 100 Plus
Blast to na_te.dros performed 2014-11-28 13:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1b 5171 Rt1b RT1B 5150bp 2769..2887 561..446 127 60.8 Minus

BO34102.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-05-14 17:50:49 Download gff for BO34102.complete
Subject Subject Range Query Range Percent Splice Strand
CG4686-RA 377..919 17..561 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:09:35 Download gff for BO34102.complete
Subject Subject Range Query Range Percent Splice Strand
CG4686-RA 338..880 17..561 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:30:40 Download gff for BO34102.complete
Subject Subject Range Query Range Percent Splice Strand
CG4686-RA 338..880 17..561 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:30:40 Download gff for BO34102.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19864989..19865297 110..418 100 -> Plus
3R 19866414..19866554 419..561 98   Plus
3R 19864833..19864925 17..109 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:09:35 Download gff for BO34102.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15690555..15690647 17..109 100 -> Plus
arm_3R 15690711..15691019 110..418 100 -> Plus
arm_3R 15692136..15692276 419..561 98   Plus

BO34102.pep Sequence

Translation from 16 to 577

> BO34102.pep
MSVADTIEYVTLGNPVSKMVASSASALLRTLGLRPKKVPVQETSMAVLPA
AHSYAHSHGSLYRLAGCHYHFIRLAGIVGASAIFMGAYCKYVLKDVSDPK
EQVDSQAFADVANRIHFLHSFAMMAMPLAHYPVFTGTLMITGMMLFSGCM
YYRALTGEKRLQPYATVGGFCLMAAWLSLVLASFLDH

BO34102.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG4686-PB 181 CG4686-PB 1..181 1..181 936 100 Plus
CG4686-PA 181 CG4686-PA 1..181 1..181 936 100 Plus
CG42395-PD 179 CG42395-PD 1..179 3..181 673 69.8 Plus