Clone BO34142 Report

Search the DGRC for BO34142

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:341
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptCG31820-RA
Protein status:BO34142.pep: Imported from assembly
Sequenced Size:220

Clone Sequence Records

BO34142.complete Sequence

220 bp assembled on 2013-05-14

GenBank Submission: KX799675

> BO34142.complete
GAAGTTATCAGTCGACATGTGTTGCCAAGGAGCCTGTGGATCGGTATCCT
ATGCCCTGGCTTATGGCCCCGTCGGACCCGCTCTGCCAGCCATGAACTAC
AATAACTGCTGCTGTGGACCCAATCCTCCCTGTGGTCCCTGGACATGTCC
TCCTAACAGGTGCTGTTGCGCCGGCGAATGGGGTTGCTTTGGGCCTTTTT
ACGCAAGCTTTCTAGACCAT

BO34142.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG31820-RB 189 CG31820-PB 1..186 17..202 885 98.4 Plus
CG31820-RA 189 CG31820-PA 1..186 17..202 885 98.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG31820-RB 419 CG31820-RB 114..299 17..202 885 98.4 Plus
CG31820-RA 440 CG31820-RA 135..320 17..202 885 98.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16005909..16006094 202..17 885 98.4 Minus
Blast to na_te.dros performed on 2014-11-28 13:34:26 has no hits.

BO34142.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-05-14 17:50:15 Download gff for BO34142.complete
Subject Subject Range Query Range Percent Splice Strand
CG31820-RA 135..320 17..204 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:08:46 Download gff for BO34142.complete
Subject Subject Range Query Range Percent Splice Strand
CG31820-RA 135..320 17..204 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:29:59 Download gff for BO34142.complete
Subject Subject Range Query Range Percent Splice Strand
CG31820-RA 135..320 17..204 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:29:59 Download gff for BO34142.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16005906..16006094 17..204 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:08:46 Download gff for BO34142.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16005906..16006094 17..204 97   Minus

BO34142.pep Sequence

Translation from 16 to 220

> BO34142.pep
MCCQGACGSVSYALAYGPVGPALPAMNYNNCCCGPNPPCGPWTCPPNRCC
CAGEWGCFGPFYASFLDH

BO34142.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG31820-PB 62 CG31820-PB 1..62 1..62 402 100 Plus
CG31820-PA 62 CG31820-PA 1..62 1..62 402 100 Plus
CG34167-PA 127 CG34167-PA 66..127 2..62 150 48.4 Plus