BO34142.complete Sequence
220 bp assembled on 2013-05-14
GenBank Submission: KX799675
> BO34142.complete
GAAGTTATCAGTCGACATGTGTTGCCAAGGAGCCTGTGGATCGGTATCCT
ATGCCCTGGCTTATGGCCCCGTCGGACCCGCTCTGCCAGCCATGAACTAC
AATAACTGCTGCTGTGGACCCAATCCTCCCTGTGGTCCCTGGACATGTCC
TCCTAACAGGTGCTGTTGCGCCGGCGAATGGGGTTGCTTTGGGCCTTTTT
ACGCAAGCTTTCTAGACCAT
BO34142.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:34:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31820-RB | 189 | CG31820-PB | 1..186 | 17..202 | 885 | 98.4 | Plus |
CG31820-RA | 189 | CG31820-PA | 1..186 | 17..202 | 885 | 98.4 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:34:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31820-RB | 419 | CG31820-RB | 114..299 | 17..202 | 885 | 98.4 | Plus |
CG31820-RA | 440 | CG31820-RA | 135..320 | 17..202 | 885 | 98.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:34:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16005909..16006094 | 202..17 | 885 | 98.4 | Minus |
Blast to na_te.dros performed on 2014-11-28 13:34:26 has no hits.
BO34142.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-05-14 17:50:15 Download gff for
BO34142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31820-RA | 135..320 | 17..204 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:08:46 Download gff for
BO34142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31820-RA | 135..320 | 17..204 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:29:59 Download gff for
BO34142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31820-RA | 135..320 | 17..204 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:29:59 Download gff for
BO34142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16005906..16006094 | 17..204 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:08:46 Download gff for
BO34142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 16005906..16006094 | 17..204 | 97 | | Minus |
BO34142.pep Sequence
Translation from 16 to 220
> BO34142.pep
MCCQGACGSVSYALAYGPVGPALPAMNYNNCCCGPNPPCGPWTCPPNRCC
CAGEWGCFGPFYASFLDH
BO34142.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:14:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31820-PB | 62 | CG31820-PB | 1..62 | 1..62 | 402 | 100 | Plus |
CG31820-PA | 62 | CG31820-PA | 1..62 | 1..62 | 402 | 100 | Plus |
CG34167-PA | 127 | CG34167-PA | 66..127 | 2..62 | 150 | 48.4 | Plus |