Clone BO34144 Report

Search the DGRC for BO34144

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:341
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG43059-RA
Protein status:BO34144.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO34144.complete Sequence

265 bp assembled on 2013-05-22

GenBank Submission: KX798045

> BO34144.complete
GAAGTTATCAGTCGACATGATTTGCGTATCACGTCTGGTCATCATCAATT
TGCCCAGTGTCTGGTCATCCAAGAGATCCAAAGACTCGGAGGAAAAGGAT
AGCAAAGATTCTGTAAAGCCAGCTGCACCCAGGGATTTTCAGAGACCTTT
GCAGATCCACACAAAAAGGGGCTACATCAAGTGGTTCAACAAGCTGAGTC
GCTGCCACAAAACTCGTCATTTTTCAGGCAGAATGCATCCCAGGCTGGCA
AGCTTTCTAGACCAT

BO34144.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG43059-RA 234 CG43059-PA 1..231 17..247 1140 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG43059-RA 377 CG43059-RA 99..329 17..247 1140 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8318590..8318731 247..106 695 99.3 Minus
3L 28110227 3L 8318778..8318868 107..17 455 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:42:57 has no hits.

BO34144.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-05-22 11:24:05 Download gff for BO34144.complete
Subject Subject Range Query Range Percent Splice Strand
CG43059-RA 99..329 17..249 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:12:59 Download gff for BO34144.complete
Subject Subject Range Query Range Percent Splice Strand
CG43059-RA 99..329 17..249 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:33:25 Download gff for BO34144.complete
Subject Subject Range Query Range Percent Splice Strand
CG43059-RA 99..329 17..249 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:33:25 Download gff for BO34144.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8318778..8318868 17..107 100   Minus
3L 8318588..8318729 108..249 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:12:59 Download gff for BO34144.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8311688..8311829 108..249 97 <- Minus
arm_3L 8311878..8311968 17..107 100   Minus

BO34144.pep Sequence

Translation from 16 to 265

> BO34144.pep
MICVSRLVIINLPSVWSSKRSKDSEEKDSKDSVKPAAPRDFQRPLQIHTK
RGYIKWFNKLSRCHKTRHFSGRMHPRLASFLDH

BO34144.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG43059-PA 77 CG43059-PA 1..77 1..77 414 100 Plus