Clone BO34149 Report

Search the DGRC for BO34149

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:341
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG18508-RA
Protein status:BO34149.pep: Imported from assembly
Sequenced Size:331

Clone Sequence Records

BO34149.complete Sequence

331 bp assembled on 2013-05-14

GenBank Submission: KX794733

> BO34149.complete
GAAGTTATCAGTCGACATGGTTTGCGTGCCCTGTATTATCATTCCACTGC
TTCTGTACATTTGGCACAAATTTGTGCAGCCGATCCTGTTGCGCTACTGG
AATCCCTGGGAGAAGAAGGACGACGATGGCAATGTGATCAAAAAGGGACC
CGACTTCCCATTCGAGTGCAAGGGCGGCGTTTGCCCCTTCGTTCCGGGCG
GCAAGAAGACGGAGAACGTCAGTGATGACGATGCCGAGGAATCTGAAAAT
CCGCCATTGAATGCAACAGCAATGGCAGCGGAAACGGAAGTGGACGAGTC
CAAGAAGGAGATCGCAAGCTTTCTAGACCAT

BO34149.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG18508-RB 300 CG18508-PB 1..297 17..313 1485 100 Plus
CG18508-RA 300 CG18508-PA 1..297 17..313 1485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG18508-RB 816 CG18508-RB 105..401 17..313 1485 100 Plus
CG18508-RA 630 CG18508-RA 105..401 17..313 1485 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3172683..3172979 313..17 1485 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:34:48 has no hits.

BO34149.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-05-14 17:50:24 Download gff for BO34149.complete
Subject Subject Range Query Range Percent Splice Strand
CG18508-RA 104..400 17..315 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:08:56 Download gff for BO34149.complete
Subject Subject Range Query Range Percent Splice Strand
CG18508-RA 105..401 17..315 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:30:08 Download gff for BO34149.complete
Subject Subject Range Query Range Percent Splice Strand
CG18508-RA 105..401 17..315 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:30:08 Download gff for BO34149.complete
Subject Subject Range Query Range Percent Splice Strand
X 3172681..3172979 17..315 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:08:56 Download gff for BO34149.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3066714..3067012 17..315 99   Minus

BO34149.pep Sequence

Translation from 16 to 331

> BO34149.pep
MVCVPCIIIPLLLYIWHKFVQPILLRYWNPWEKKDDDGNVIKKGPDFPFE
CKGGVCPFVPGGKKTENVSDDDAEESENPPLNATAMAAETEVDESKKEIA
SFLDH

BO34149.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG18508-PB 99 CG18508-PB 1..99 1..99 550 100 Plus
CG18508-PA 99 CG18508-PA 1..99 1..99 550 100 Plus