Clone BO34252 Report

Search the DGRC for BO34252

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:342
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG32811-RB
Protein status:BO34252.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO34252.complete Sequence

265 bp assembled on 2013-05-14

GenBank Submission: KX793781

> BO34252.complete
GAAGTTATCAGTCGACATGGACCTCATTGTGCCACCGAACGGACTCTATG
AGATGCCACACCAACCAGAGTATCCGGATTATGAGGCGATGAGAAGACCG
GTAGAGTCGTTGCGCATGGTGAAGCAGAAGGAAGTTCTGGTCGATAGGGA
ACTCGAGTTTTTCTTCAATACGGAAGATATAACGAAAGTCAATTCCGAGG
TGTTTCGAGGTGTGACTAGTGGTCACAGCACAGAATTTGGGACTCGTGCA
AGCTTTCTAGACCAT

BO34252.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG32811-RB 234 CG32811-PB 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:33:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG32811-RB 404 CG32811-RB 56..287 16..247 1160 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1298101..1298332 247..16 1160 100 Minus
Blast to na_te.dros performed 2014-11-28 13:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
Fw2 3961 Fw2 FW2 3961bp 587..628 177..137 99 73.8 Minus

BO34252.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-05-14 17:49:57 Download gff for BO34252.complete
Subject Subject Range Query Range Percent Splice Strand
CG32811-RB 57..287 17..249 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:08:20 Download gff for BO34252.complete
Subject Subject Range Query Range Percent Splice Strand
CG32811-RB 57..287 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:29:40 Download gff for BO34252.complete
Subject Subject Range Query Range Percent Splice Strand
CG32811-RB 57..287 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:29:40 Download gff for BO34252.complete
Subject Subject Range Query Range Percent Splice Strand
X 1298097..1298331 17..249 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:08:20 Download gff for BO34252.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1192130..1192364 17..249 99   Minus

BO34252.pep Sequence

Translation from 16 to 265

> BO34252.pep
MDLIVPPNGLYEMPHQPEYPDYEAMRRPVESLRMVKQKEVLVDRELEFFF
NTEDITKVNSEVFRGVTSGHSTEFGTRASFLDH

BO34252.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG32811-PB 77 CG32811-PB 1..77 1..77 405 100 Plus