Clone BO34301 Report

Search the DGRC for BO34301

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:343
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG15308-RB
Protein status:BO34301.pep: Imported from assembly
Sequenced Size:319

Clone Sequence Records

BO34301.complete Sequence

319 bp assembled on 2013-09-16

GenBank Submission: KX795542

> BO34301.complete
GAAGTTATCAGTCGACATGAAGTTCTTCATCGCCGCCTTCCTGATCGCCG
CCTGCATGGCCCTCGCCCAGTGCAGTGTCATCTACTCGCCGGTGTCCTCC
GTTCCGGTGGTCCGTTCCGTGCCCGTTATTCGCTCCGTTCCGGTGGTGCG
CAGTGTGCCTGTGGTCCGCCGTGTGCCGGTGGTTCGCCGTGTCAATGTGG
TCGAGTCCGTTCCAGTGGTGCCCTCGGTGGTGCGCGTTGGACAGGCCCCC
ATCTACGATGCTCCACTGGTGCAGTCCTATGGTGGATGGTTGAAGCAGAA
GGCAAGCTTTCTAGACCAT

BO34301.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG15308-RB 288 CG15308-PB 1..285 17..301 1425 100 Plus
CG15308-RC 249 CG15308-PC 1..246 56..301 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG15308-RB 532 CG15308-RB 60..346 15..301 1435 100 Plus
CG15308-RC 494 CG15308-RC 118..401 18..301 1405 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10218099..10218379 301..21 1405 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:49:59 has no hits.

BO34301.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:50:11 Download gff for BO34301.complete
Subject Subject Range Query Range Percent Splice Strand
CG15308-RB 62..346 17..303 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:35:51 Download gff for BO34301.complete
Subject Subject Range Query Range Percent Splice Strand
CG15308-RB 62..346 17..303 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:35:51 Download gff for BO34301.complete
Subject Subject Range Query Range Percent Splice Strand
X 10218097..10218382 17..303 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:50:11 Download gff for BO34301.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10112130..10112415 17..303 98   Minus

BO34301.pep Sequence

Translation from 16 to 319

> BO34301.pep
MKFFIAAFLIAACMALAQCSVIYSPVSSVPVVRSVPVIRSVPVVRSVPVV
RRVPVVRRVNVVESVPVVPSVVRVGQAPIYDAPLVQSYGGWLKQKASFLD
H

BO34301.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG15308-PB 95 CG15308-PB 1..95 1..95 470 100 Plus
CG15308-PC 82 CG15308-PC 1..82 14..95 405 100 Plus
CG34268-PA 83 CG34268-PA 5..70 5..70 140 48.5 Plus