Clone BO34305 Report

Search the DGRC for BO34305

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:343
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCG34194-RA
Protein status:BO34305.pep: Imported from assembly
Sequenced Size:346

Clone Sequence Records

BO34305.complete Sequence

346 bp assembled on 2013-09-16

GenBank Submission: KX797046

> BO34305.complete
GAAGTTATCAGTCGACATGTCGCAAAGCATGTTCCCAAAGCTGGCCGAGG
ATTACGCGAAATTCAAGCGCTATGTGAAATGGCTGTACACCCTCTACGAA
CTGAACACACAGATCGCCATATGTGAGCCGTGGGAAAAGGTCTTCCTCAA
TGTCCTCCTCGGCAGCTTCGTCTCCCTGATCCTCTACGCATCCTTTGCCT
TTGTGCCGGGCTATTGTGTCACCGTCTTCCAGCTTTTATGGCCCCAAACG
AGCGTGCAAAATCTCACCAGCGTTTGCAGTACGAGTACGGAGGGCTTTTG
CGGCAACGAAAGCGGATCAGTAATAACAGCAAGCTTTCTAGACCAT

BO34305.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG34194-RB 315 CG34194-PB 1..312 17..328 1560 100 Plus
CG34194-RA 315 CG34194-PA 1..312 17..328 1560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG34194-RB 655 CG34194-RB 298..610 16..328 1565 100 Plus
CG34194-RA 413 CG34194-RA 56..368 16..328 1565 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17544822..17545000 150..328 895 100 Plus
2R 25286936 2R 17544487..17544620 16..149 670 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:50:10 has no hits.

BO34305.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:50:15 Download gff for BO34305.complete
Subject Subject Range Query Range Percent Splice Strand
CG34194-RA 57..368 17..330 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:35:55 Download gff for BO34305.complete
Subject Subject Range Query Range Percent Splice Strand
CG34194-RA 57..368 17..330 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:35:55 Download gff for BO34305.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17544488..17544620 17..149 100 -> Plus
2R 17544822..17545000 150..330 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:50:15 Download gff for BO34305.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13431993..13432125 17..149 100 -> Plus
arm_2R 13432327..13432505 150..330 98   Plus

BO34305.pep Sequence

Translation from 16 to 346

> BO34305.pep
MSQSMFPKLAEDYAKFKRYVKWLYTLYELNTQIAICEPWEKVFLNVLLGS
FVSLILYASFAFVPGYCVTVFQLLWPQTSVQNLTSVCSTSTEGFCGNESG
SVITASFLDH

BO34305.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34194-PB 104 CG34194-PB 1..104 1..104 550 100 Plus
CG34194-PA 104 CG34194-PA 1..104 1..104 550 100 Plus