Clone BO34319 Report

Search the DGRC for BO34319

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:343
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptCG42489-RA
Protein status:BO34319.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO34319.complete Sequence

265 bp assembled on 2013-09-16

GenBank Submission: KX795034

> BO34319.complete
GAAGTTATCAGTCGACATGCAGAAGCCACATCATGGTCCGTGCTGGATGT
TGCTTCTACTGGCATCGCTGATCGGTACTTTTATGCTGGCCTTCAGCTAC
TGGATGTTTGTGCCGCGCGAGGAGTCACTATGGTCAATGATATCGAACTA
CAGTGGATCTGGAATAAAGTACTCCCTGCCGCCGTCAGCAGTACCTGAGG
AACTTAAGCTTCGGCAGAGACCGCCCTTCGTTTACCAGATATTACATGCA
AGCTTTCTAGACCAT

BO34319.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG42489-RB 234 CG42489-PB 1..231 17..247 1155 100 Plus
CG42489-RC 234 CG42489-PC 1..231 17..247 1155 100 Plus
CG42489-RA 234 CG42489-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG42489-RB 511 CG42489-RB 204..434 17..247 1155 100 Plus
CG42489-RC 373 CG42489-RC 66..296 17..247 1155 100 Plus
CG42489-RA 442 CG42489-RA 135..365 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8653879..8654109 247..17 1155 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:51:03 has no hits.

BO34319.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:50:32 Download gff for BO34319.complete
Subject Subject Range Query Range Percent Splice Strand
CG42489-RA 135..365 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:11 Download gff for BO34319.complete
Subject Subject Range Query Range Percent Splice Strand
CG42489-RA 135..365 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:11 Download gff for BO34319.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8653876..8654109 17..249 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:50:32 Download gff for BO34319.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4479598..4479831 17..249 99   Minus

BO34319.pep Sequence

Translation from 16 to 265

> BO34319.pep
MQKPHHGPCWMLLLLASLIGTFMLAFSYWMFVPREESLWSMISNYSGSGI
KYSLPPSAVPEELKLRQRPPFVYQILHASFLDH

BO34319.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG42489-PB 77 CG42489-PB 1..77 1..77 419 100 Plus
CG42489-PC 77 CG42489-PC 1..77 1..77 419 100 Plus
CG42489-PA 77 CG42489-PA 1..77 1..77 419 100 Plus