BO34319.complete Sequence
265 bp assembled on 2013-09-16
GenBank Submission: KX795034
> BO34319.complete
GAAGTTATCAGTCGACATGCAGAAGCCACATCATGGTCCGTGCTGGATGT
TGCTTCTACTGGCATCGCTGATCGGTACTTTTATGCTGGCCTTCAGCTAC
TGGATGTTTGTGCCGCGCGAGGAGTCACTATGGTCAATGATATCGAACTA
CAGTGGATCTGGAATAAAGTACTCCCTGCCGCCGTCAGCAGTACCTGAGG
AACTTAAGCTTCGGCAGAGACCGCCCTTCGTTTACCAGATATTACATGCA
AGCTTTCTAGACCAT
BO34319.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:51:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42489-RB | 234 | CG42489-PB | 1..231 | 17..247 | 1155 | 100 | Plus |
CG42489-RC | 234 | CG42489-PC | 1..231 | 17..247 | 1155 | 100 | Plus |
CG42489-RA | 234 | CG42489-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:51:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42489-RB | 511 | CG42489-RB | 204..434 | 17..247 | 1155 | 100 | Plus |
CG42489-RC | 373 | CG42489-RC | 66..296 | 17..247 | 1155 | 100 | Plus |
CG42489-RA | 442 | CG42489-RA | 135..365 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:51:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 8653879..8654109 | 247..17 | 1155 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 13:51:03 has no hits.
BO34319.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:50:32 Download gff for
BO34319.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42489-RA | 135..365 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:11 Download gff for
BO34319.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42489-RA | 135..365 | 17..249 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:11 Download gff for
BO34319.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8653876..8654109 | 17..249 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:50:32 Download gff for
BO34319.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 4479598..4479831 | 17..249 | 99 | | Minus |
BO34319.pep Sequence
Translation from 16 to 265
> BO34319.pep
MQKPHHGPCWMLLLLASLIGTFMLAFSYWMFVPREESLWSMISNYSGSGI
KYSLPPSAVPEELKLRQRPPFVYQILHASFLDH
BO34319.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42489-PB | 77 | CG42489-PB | 1..77 | 1..77 | 419 | 100 | Plus |
CG42489-PC | 77 | CG42489-PC | 1..77 | 1..77 | 419 | 100 | Plus |
CG42489-PA | 77 | CG42489-PA | 1..77 | 1..77 | 419 | 100 | Plus |