BO34348.complete Sequence
226 bp assembled on 2013-09-16
GenBank Submission: KX796859
> BO34348.complete
GAAGTTATCAGTCGACATGTTCAAGCTGCTGGTTGTCGTTTTCGCTGCCC
TCTTCGCCGCTGCTCTGGCTGTTCCCGCTCCAGTTGCCCGTGCCAATCCC
GCCCCAATCCCGATTGCCAGCCCCGAGCCCGCCCCCCAGTACTACTACGG
AGCTAGCCCATACGCCTACTCCGGAGGATACTACGATTCGCCCTACTCCT
ACTACGGCGCAAGCTTTCTAGACCAT
BO34348.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:51:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Nplp4-RB | 195 | CG15361-PB | 1..192 | 17..208 | 960 | 100 | Plus |
Nplp4-RA | 195 | CG15361-PA | 1..192 | 17..208 | 960 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:51:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Nplp4-RB | 528 | CG15361-RB | 115..308 | 15..208 | 970 | 100 | Plus |
Nplp4-RA | 380 | CG15361-RA | 73..266 | 15..208 | 970 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:51:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2008672..2008852 | 28..208 | 905 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 13:51:25 has no hits.
BO34348.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:50:40 Download gff for
BO34348.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp4-RA | 80..266 | 22..210 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:17 Download gff for
BO34348.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp4-RA | 80..266 | 22..210 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:17 Download gff for
BO34348.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2008668..2008852 | 22..210 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:50:40 Download gff for
BO34348.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2008668..2008852 | 22..210 | 96 | | Plus |
BO34348.pep Sequence
Translation from 16 to 226
> BO34348.pep
MFKLLVVVFAALFAAALAVPAPVARANPAPIPIASPEPAPQYYYGASPYA
YSGGYYDSPYSYYGASFLDH
BO34348.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Nplp4-PB | 64 | CG15361-PB | 1..64 | 1..64 | 339 | 100 | Plus |
Nplp4-PA | 64 | CG15361-PA | 1..64 | 1..64 | 339 | 100 | Plus |