Clone BO34348 Report

Search the DGRC for BO34348

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:343
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptNplp4-RA
Protein status:BO34348.pep: Imported from assembly
Sequenced Size:226

Clone Sequence Records

BO34348.complete Sequence

226 bp assembled on 2013-09-16

GenBank Submission: KX796859

> BO34348.complete
GAAGTTATCAGTCGACATGTTCAAGCTGCTGGTTGTCGTTTTCGCTGCCC
TCTTCGCCGCTGCTCTGGCTGTTCCCGCTCCAGTTGCCCGTGCCAATCCC
GCCCCAATCCCGATTGCCAGCCCCGAGCCCGCCCCCCAGTACTACTACGG
AGCTAGCCCATACGCCTACTCCGGAGGATACTACGATTCGCCCTACTCCT
ACTACGGCGCAAGCTTTCTAGACCAT

BO34348.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp4-RB 195 CG15361-PB 1..192 17..208 960 100 Plus
Nplp4-RA 195 CG15361-PA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp4-RB 528 CG15361-RB 115..308 15..208 970 100 Plus
Nplp4-RA 380 CG15361-RA 73..266 15..208 970 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2008672..2008852 28..208 905 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:51:25 has no hits.

BO34348.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:50:40 Download gff for BO34348.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp4-RA 80..266 22..210 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:17 Download gff for BO34348.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp4-RA 80..266 22..210 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:17 Download gff for BO34348.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2008668..2008852 22..210 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:50:40 Download gff for BO34348.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2008668..2008852 22..210 96   Plus

BO34348.pep Sequence

Translation from 16 to 226

> BO34348.pep
MFKLLVVVFAALFAAALAVPAPVARANPAPIPIASPEPAPQYYYGASPYA
YSGGYYDSPYSYYGASFLDH

BO34348.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp4-PB 64 CG15361-PB 1..64 1..64 339 100 Plus
Nplp4-PA 64 CG15361-PA 1..64 1..64 339 100 Plus