Clone BO34356 Report

Search the DGRC for BO34356

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:343
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG42464-RA
Protein status:BO34356.pep: Imported from assembly
Sequenced Size:295

Clone Sequence Records

BO34356.complete Sequence

295 bp assembled on 2013-09-16

GenBank Submission: KX797008

> BO34356.complete
GAAGTTATCAGTCGACATGTTCATCAATATATGGTATTTATTCATAGCAT
TAGCTGGTGTTAATGCGGAATCAGCAGATGAAATCTGTCAACTTACGCCT
GAGGCTAATGGCTTTGGGAAAATTATGTCCTGTGCACACTACTCGAATTG
GTTTTCCTATCATTCAGATAAAAACGAATGTCTGGAGTTTTCATACGGAG
GCTGTGGTGGCAACGAAAATAGGTTTCAAACTAAAGCAATTTGCGAAGAT
CTCTGCAAAAATAAAGTTGAGCAGCTTGCAAGCTTTCTAGACCAT

BO34356.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG42464-RA 264 CG42464-PA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG42464-RA 300 CG42464-RA 30..290 17..277 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3699619..3699816 80..277 990 100 Plus
2L 23513712 2L 3699493..3699556 17..80 320 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:52:39 has no hits.

BO34356.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:51:08 Download gff for BO34356.complete
Subject Subject Range Query Range Percent Splice Strand
CG42464-RA 35..290 22..279 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:45 Download gff for BO34356.complete
Subject Subject Range Query Range Percent Splice Strand
CG42464-RA 35..290 22..279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:45 Download gff for BO34356.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3699498..3699556 22..80 100 -> Plus
2L 3699620..3699816 81..279 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:51:08 Download gff for BO34356.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3699498..3699556 22..80 100 -> Plus
arm_2L 3699620..3699816 81..279 98   Plus

BO34356.pep Sequence

Translation from 16 to 295

> BO34356.pep
MFINIWYLFIALAGVNAESADEICQLTPEANGFGKIMSCAHYSNWFSYHS
DKNECLEFSYGGCGGNENRFQTKAICEDLCKNKVEQLASFLDH

BO34356.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG42464-PA 87 CG42464-PA 1..87 1..87 484 100 Plus
CG16713-PA 82 CG16713-PA 8..80 7..80 179 45.9 Plus
CG16712-PB 82 CG16712-PB 3..81 2..81 174 46.2 Plus
CG16712-PA 82 CG16712-PA 3..81 2..81 174 46.2 Plus
Acp24A4-PC 78 CG31779-PC 8..76 7..80 136 42.7 Plus