BO34356.complete Sequence
295 bp assembled on 2013-09-16
GenBank Submission: KX797008
> BO34356.complete
GAAGTTATCAGTCGACATGTTCATCAATATATGGTATTTATTCATAGCAT
TAGCTGGTGTTAATGCGGAATCAGCAGATGAAATCTGTCAACTTACGCCT
GAGGCTAATGGCTTTGGGAAAATTATGTCCTGTGCACACTACTCGAATTG
GTTTTCCTATCATTCAGATAAAAACGAATGTCTGGAGTTTTCATACGGAG
GCTGTGGTGGCAACGAAAATAGGTTTCAAACTAAAGCAATTTGCGAAGAT
CTCTGCAAAAATAAAGTTGAGCAGCTTGCAAGCTTTCTAGACCAT
BO34356.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:52:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42464-RA | 264 | CG42464-PA | 1..261 | 17..277 | 1305 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:52:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42464-RA | 300 | CG42464-RA | 30..290 | 17..277 | 1305 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:52:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3699619..3699816 | 80..277 | 990 | 100 | Plus |
2L | 23513712 | 2L | 3699493..3699556 | 17..80 | 320 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 13:52:39 has no hits.
BO34356.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:51:08 Download gff for
BO34356.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42464-RA | 35..290 | 22..279 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:45 Download gff for
BO34356.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42464-RA | 35..290 | 22..279 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:45 Download gff for
BO34356.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3699498..3699556 | 22..80 | 100 | -> | Plus |
2L | 3699620..3699816 | 81..279 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:51:08 Download gff for
BO34356.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3699498..3699556 | 22..80 | 100 | -> | Plus |
arm_2L | 3699620..3699816 | 81..279 | 98 | | Plus |
BO34356.pep Sequence
Translation from 16 to 295
> BO34356.pep
MFINIWYLFIALAGVNAESADEICQLTPEANGFGKIMSCAHYSNWFSYHS
DKNECLEFSYGGCGGNENRFQTKAICEDLCKNKVEQLASFLDH
BO34356.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42464-PA | 87 | CG42464-PA | 1..87 | 1..87 | 484 | 100 | Plus |
CG16713-PA | 82 | CG16713-PA | 8..80 | 7..80 | 179 | 45.9 | Plus |
CG16712-PB | 82 | CG16712-PB | 3..81 | 2..81 | 174 | 46.2 | Plus |
CG16712-PA | 82 | CG16712-PA | 3..81 | 2..81 | 174 | 46.2 | Plus |
Acp24A4-PC | 78 | CG31779-PC | 8..76 | 7..80 | 136 | 42.7 | Plus |