Clone BO34357 Report

Search the DGRC for BO34357

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:343
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG13998-RA
Protein status:BO34357.pep: Imported from assembly
Sequenced Size:325

Clone Sequence Records

BO34357.complete Sequence

325 bp assembled on 2013-09-16

GenBank Submission: KX798404

> BO34357.complete
GAAGTTATCAGTCGACATGGCTAAGACGATGACGTTCTGGTTTCTGGTCT
TGGCTCTGGTGACCTTAAATCCAACCTGGCCATTCTGGCGCACAGGGGCT
GCCGAAGTCACTTCCGCATCGATGTTCCAGTTTCTGGACCGCCACAATGG
TGAAGGCGACCACAGTTGGTCTCACCTACTGCCCACAAACTTCTACTCCG
AGATGAACCAGCAGTACTACAGGAGATTCCGGCGACAGGCTGGCAGAATG
GACACCTTCCGATCGGGAAAACGGCAGCAGTACCCTTTTGAATATGCTCG
ATATGTCGCAAGCTTTCTAGACCAT

BO34357.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13998-RA 294 CG13998-PA 1..291 17..307 1455 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG13998-RA 331 CG13998-RA 15..305 17..307 1455 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5956515..5956805 307..17 1455 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:52:45 has no hits.

BO34357.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:51:10 Download gff for BO34357.complete
Subject Subject Range Query Range Percent Splice Strand
CG13998-RA 15..305 17..309 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:47 Download gff for BO34357.complete
Subject Subject Range Query Range Percent Splice Strand
CG13998-RA 15..305 17..309 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:47 Download gff for BO34357.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5956512..5956805 17..309 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:51:10 Download gff for BO34357.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5956512..5956805 17..309 99   Minus

BO34357.pep Sequence

Translation from 16 to 325

> BO34357.pep
MAKTMTFWFLVLALVTLNPTWPFWRTGAAEVTSASMFQFLDRHNGEGDHS
WSHLLPTNFYSEMNQQYYRRFRRQAGRMDTFRSGKRQQYPFEYARYVASF
LDH

BO34357.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13998-PA 97 CG13998-PA 1..97 1..97 535 100 Plus