Clone BO34358 Report

Search the DGRC for BO34358

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:343
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG34212-RA
Protein status:BO34358.pep: Imported from assembly
Sequenced Size:178

Clone Sequence Records

BO34358.complete Sequence

178 bp assembled on 2013-09-16

GenBank Submission: KX793914

> BO34358.complete
GAAGTTATCAGTCGACATGATTGCCACAACGGTGTGTTTCTACTTGGTGG
TCTTGGCCATTCTCATGGCCTTCCTGTCTCCCACAGCAGATGGTTGCTTC
ATCCTGCTTGCGTGCCTGTTGAAGTCACCCCTCTGTCCGTTCAACACCAC
ATCATCTGGAGCAAGCTTTCTAGACCAT

BO34358.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34212-RA 147 CG34212-PA 1..144 17..160 720 100 Plus
CG34212-RB 147 CG34212-PB 1..144 17..160 720 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34212-RA 274 CG34212-RA 26..169 17..160 720 100 Plus
CG34212-RB 358 CG34212-RB 110..253 17..160 720 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6049979..6050122 160..17 720 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:51:59 has no hits.

BO34358.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:50:54 Download gff for BO34358.complete
Subject Subject Range Query Range Percent Splice Strand
CG34212-RB 110..253 17..162 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:29 Download gff for BO34358.complete
Subject Subject Range Query Range Percent Splice Strand
CG34212-RB 110..253 17..162 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:29 Download gff for BO34358.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6049976..6050122 17..162 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:50:54 Download gff for BO34358.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1937481..1937627 17..162 98   Minus

BO34358.pep Sequence

Translation from 16 to 178

> BO34358.pep
MIATTVCFYLVVLAILMAFLSPTADGCFILLACLLKSPLCPFNTTSSGAS
FLDH

BO34358.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34212-PA 48 CG34212-PA 1..48 1..48 248 100 Plus
CG34212-PB 48 CG34212-PB 1..48 1..48 248 100 Plus