BO34358.complete Sequence
178 bp assembled on 2013-09-16
GenBank Submission: KX793914
> BO34358.complete
GAAGTTATCAGTCGACATGATTGCCACAACGGTGTGTTTCTACTTGGTGG
TCTTGGCCATTCTCATGGCCTTCCTGTCTCCCACAGCAGATGGTTGCTTC
ATCCTGCTTGCGTGCCTGTTGAAGTCACCCCTCTGTCCGTTCAACACCAC
ATCATCTGGAGCAAGCTTTCTAGACCAT
BO34358.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:52:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34212-RA | 147 | CG34212-PA | 1..144 | 17..160 | 720 | 100 | Plus |
CG34212-RB | 147 | CG34212-PB | 1..144 | 17..160 | 720 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:52:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34212-RA | 274 | CG34212-RA | 26..169 | 17..160 | 720 | 100 | Plus |
CG34212-RB | 358 | CG34212-RB | 110..253 | 17..160 | 720 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:51:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 6049979..6050122 | 160..17 | 720 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 13:51:59 has no hits.
BO34358.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:50:54 Download gff for
BO34358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34212-RB | 110..253 | 17..162 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:29 Download gff for
BO34358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34212-RB | 110..253 | 17..162 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:29 Download gff for
BO34358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6049976..6050122 | 17..162 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:50:54 Download gff for
BO34358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 1937481..1937627 | 17..162 | 98 | | Minus |
BO34358.pep Sequence
Translation from 16 to 178
> BO34358.pep
MIATTVCFYLVVLAILMAFLSPTADGCFILLACLLKSPLCPFNTTSSGAS
FLDH
BO34358.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34212-PA | 48 | CG34212-PA | 1..48 | 1..48 | 248 | 100 | Plus |
CG34212-PB | 48 | CG34212-PB | 1..48 | 1..48 | 248 | 100 | Plus |