BO34361.complete Sequence
184 bp assembled on 2013-09-16
GenBank Submission: KX798061
> BO34361.complete
GAAGTTATCAGTCGACATGCATTGTTATATTCCTATTGCGTTTTGCTTGT
TCGCTCTTTTGGAATTAACAAACGGGGTGAACGAAAAGGAAAGTTCTACC
TATTGTGTATCCTATTTTAATGGTGTATGCTGGGATAAAAGATTTAATAT
GTGGCCCACGGGAAAGGCAAGCTTTCTAGACCAT
BO34361.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:53:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A4-RA | 153 | CG42604-PA | 1..150 | 17..166 | 750 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:53:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A4-RA | 244 | CG42604-RA | 17..166 | 17..166 | 750 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:53:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11837259..11837408 | 17..166 | 750 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 13:53:06 has no hits.
BO34361.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:51:15 Download gff for
BO34361.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A4-RA | 17..166 | 17..168 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:53 Download gff for
BO34361.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A4-RA | 17..166 | 17..168 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:53 Download gff for
BO34361.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11837259..11837408 | 17..168 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:51:15 Download gff for
BO34361.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11837259..11837408 | 17..168 | 98 | | Plus |
BO34361.pep Sequence
Translation from 16 to 184
> BO34361.pep
MHCYIPIAFCLFALLELTNGVNEKESSTYCVSYFNGVCWDKRFNMWPTGK
ASFLDH
BO34361.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A4-PA | 50 | CG42604-PA | 1..50 | 1..50 | 289 | 100 | Plus |
Sfp33A2-PA | 50 | CG42473-PA | 1..50 | 1..50 | 138 | 48 | Plus |