Clone BO34361 Report

Search the DGRC for BO34361

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:343
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptSfp33A4-RA
Protein status:BO34361.pep: Imported from assembly
Sequenced Size:184

Clone Sequence Records

BO34361.complete Sequence

184 bp assembled on 2013-09-16

GenBank Submission: KX798061

> BO34361.complete
GAAGTTATCAGTCGACATGCATTGTTATATTCCTATTGCGTTTTGCTTGT
TCGCTCTTTTGGAATTAACAAACGGGGTGAACGAAAAGGAAAGTTCTACC
TATTGTGTATCCTATTTTAATGGTGTATGCTGGGATAAAAGATTTAATAT
GTGGCCCACGGGAAAGGCAAGCTTTCTAGACCAT

BO34361.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A4-RA 153 CG42604-PA 1..150 17..166 750 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A4-RA 244 CG42604-RA 17..166 17..166 750 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11837259..11837408 17..166 750 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:53:06 has no hits.

BO34361.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:51:15 Download gff for BO34361.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A4-RA 17..166 17..168 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:53 Download gff for BO34361.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A4-RA 17..166 17..168 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:53 Download gff for BO34361.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11837259..11837408 17..168 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:51:15 Download gff for BO34361.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11837259..11837408 17..168 98   Plus

BO34361.pep Sequence

Translation from 16 to 184

> BO34361.pep
MHCYIPIAFCLFALLELTNGVNEKESSTYCVSYFNGVCWDKRFNMWPTGK
ASFLDH

BO34361.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A4-PA 50 CG42604-PA 1..50 1..50 289 100 Plus
Sfp33A2-PA 50 CG42473-PA 1..50 1..50 138 48 Plus