Clone BO34362 Report

Search the DGRC for BO34362

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:343
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG42833-RA
Protein status:BO34362.pep: Imported from assembly
Sequenced Size:295

Clone Sequence Records

BO34362.complete Sequence

295 bp assembled on 2013-09-16

GenBank Submission: KX799463

> BO34362.complete
GAAGTTATCAGTCGACATGCGAGCATCCAGAGGAAATGGATTTTCATTTT
ACTTGATCTTTTCATTGCTGCTAATCTGCAAATTGGAAAGGATCTTAGGT
GATGTAAGCCCGGCAGATGAGAAATCGATAGAGTCAAATATCGTCACAAT
TTGGGATCGAATTGCAAGCGGAGTTATAAACTATCCCTGGAAAACTAATA
TCATTGAGAAGGAGAGCCCAGAAACTACTAAGAGGAGATCGGTTCTATGG
CAAAGACTAACGATGGCCACAGTTCTTGCAAGCTTTCTAGACCAT

BO34362.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG42833-RA 264 CG42833-PA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG42833-RA 395 CG42833-RA 26..286 17..277 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20200118..20200378 17..277 1305 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:53:12 has no hits.

BO34362.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:51:16 Download gff for BO34362.complete
Subject Subject Range Query Range Percent Splice Strand
CG42833-RA 26..286 17..279 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:55 Download gff for BO34362.complete
Subject Subject Range Query Range Percent Splice Strand
CG42833-RA 26..286 17..279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:55 Download gff for BO34362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20200118..20200378 17..279 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:51:16 Download gff for BO34362.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20193218..20193478 17..279 99   Plus

BO34362.pep Sequence

Translation from 16 to 295

> BO34362.pep
MRASRGNGFSFYLIFSLLLICKLERILGDVSPADEKSIESNIVTIWDRIA
SGVINYPWKTNIIEKESPETTKRRSVLWQRLTMATVLASFLDH

BO34362.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG42833-PA 87 CG42833-PA 1..87 1..87 444 100 Plus