Clone BO34371 Report

Search the DGRC for BO34371

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:343
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG9669-RA
Protein status:BO34371.pep: Imported from assembly
Sequenced Size:268

Clone Sequence Records

BO34371.complete Sequence

268 bp assembled on 2013-09-16

GenBank Submission: KX797757

> BO34371.complete
GAAGTTATCAGTCGACATGGACGTAATGCAGCGCTACGTATCGCCCGTGA
ACCCGGCCGTTTTTCCCCACCTCGCCACCGTGCTTTTGGTCATCGGAACC
TTCTTCACCGCCTGGTTCTTCATCTTTGTGGTGTCTCGAAAGAGCTCTAA
GGAAAGCACCTTGATAAAGGAACTGCTGATTAGCCTGTGCGCCTCCATTT
TCCTGGGATTCGGCATTGTTTTCCTGCTTCTAACCGTCGGTATTTACGTA
GCAAGCTTTCTAGACCAT

BO34371.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG9669-RB 237 CG9669-PB 1..234 17..250 1170 100 Plus
CG9669-RA 237 CG9669-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG9669-RB 345 CG9669-RB 52..285 17..250 1170 100 Plus
CG9669-RA 367 CG9669-RA 74..307 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16844628..16844861 250..17 1170 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:52:58 has no hits.

BO34371.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:51:14 Download gff for BO34371.complete
Subject Subject Range Query Range Percent Splice Strand
CG9669-RA 74..307 17..252 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:36:51 Download gff for BO34371.complete
Subject Subject Range Query Range Percent Splice Strand
CG9669-RA 74..307 17..252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:36:51 Download gff for BO34371.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16844625..16844861 17..252 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:51:14 Download gff for BO34371.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16837725..16837961 17..252 99   Minus

BO34371.pep Sequence

Translation from 16 to 268

> BO34371.pep
MDVMQRYVSPVNPAVFPHLATVLLVIGTFFTAWFFIFVVSRKSSKESTLI
KELLISLCASIFLGFGIVFLLLTVGIYVASFLDH

BO34371.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG9669-PB 78 CG9669-PB 1..78 1..78 388 100 Plus
CG9669-PA 78 CG9669-PA 1..78 1..78 388 100 Plus