Clone BO34377 Report

Search the DGRC for BO34377

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:343
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG15657-RA
Protein status:BO34377.pep: Imported from assembly
Sequenced Size:373

Clone Sequence Records

BO34377.complete Sequence

373 bp assembled on 2013-09-16

GenBank Submission: KX800118

> BO34377.complete
GAAGTTATCAGTCGACATGCTGATCTACTATATTTATAGTGTGCTCGAAG
CCATTTCGTATGCGATCTACACAACAGTGGCCACCATTTCGAGCATTGAA
CAGGCCCTAATCAACCTGATGATGTCCACATTTCTGTTTGTGCTTGGGAT
AGCGTGTCACCCGGTAATGGTGATTCCCCTGATGCTGGGAGGCTACTATA
TTCTACGCAACTGTTTGAATCGTCGGACCAAGGCGCCAAGGCTGCAGAGT
TCCGTGGATGGCGATGCCGGACTGATCACGGCAGGACCACGTAAAGTGCC
ACGTTTTCCCTCTCATCGCAGCCTCGCTCTCGGCGTTGACGCTCCCAAGG
ACAACGCAAGCTTTCTAGACCAT

BO34377.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG15657-RB 342 CG15657-PB 1..339 17..355 1680 99.7 Plus
CG15657-RA 342 CG15657-PA 1..339 17..355 1680 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15657-RB 475 CG15657-RB 40..378 17..355 1680 99.7 Plus
CG15657-RA 617 CG15657-RA 40..378 17..355 1680 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21147717..21147970 355..102 1270 100 Minus
2R 25286936 2R 21148030..21148114 101..17 410 98.8 Minus
Blast to na_te.dros performed on 2014-11-28 13:48:51 has no hits.

BO34377.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:49:47 Download gff for BO34377.complete
Subject Subject Range Query Range Percent Splice Strand
CG15657-RA 40..378 17..357 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:35:35 Download gff for BO34377.complete
Subject Subject Range Query Range Percent Splice Strand
CG15657-RA 40..378 17..357 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:35:35 Download gff for BO34377.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21147715..21147970 102..357 99 <- Minus
2R 21148030..21148114 17..101 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:49:47 Download gff for BO34377.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17035220..17035475 102..357 99 <- Minus
arm_2R 17035535..17035619 17..101 98   Minus

BO34377.pep Sequence

Translation from 16 to 373

> BO34377.pep
MLIYYIYSVLEAISYAIYTTVATISSIEQALINLMMSTFLFVLGIACHPV
MVIPLMLGGYYILRNCLNRRTKAPRLQSSVDGDAGLITAGPRKVPRFPSH
RSLALGVDAPKDNASFLDH

BO34377.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15657-PB 113 CG15657-PB 1..113 1..113 573 100 Plus
CG15657-PA 113 CG15657-PA 1..113 1..113 573 100 Plus