Clone BO34404 Report

Search the DGRC for BO34404

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:344
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG13177-RA
Protein status:BO34404.pep: Imported from assembly
Sequenced Size:304

Clone Sequence Records

BO34404.complete Sequence

304 bp assembled on 2013-09-16

GenBank Submission: KX800028

> BO34404.complete
GAAGTTATCAGTCGACATGGCAAAGTTATTTTCCATCCTTTTGTGCCTGG
CTATTATCGGATTCATCAGCGCAGCTCCTATAGAGGACAAGAAACCCGCT
GAGGAGGCTGATCTCTCCACCGCGGACTCCATTGGCTACGGCTACTATGC
AGCTCCATCGCCAATTTACTACGGCGGCTATGGAGGTGGCTACAAGTACG
GCGGATATTCCGGTTACGGCGGCTACGGCGGATATCGCTCCTACGGAGGC
GGATTCTATCGTCCCCGAATTTACCCAGTTTGGGGAGCAAGCTTTCTAGA
CCAT

BO34404.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG13177-RB 273 CG13177-PB 1..270 17..286 1350 100 Plus
CG13177-RA 273 CG13177-PA 1..270 17..286 1350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13177-RB 1099 CG13177-RB 118..387 17..286 1350 100 Plus
CG13177-RA 639 CG13177-RA 118..387 17..286 1350 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12163982..12164184 84..286 1015 100 Plus
2R 25286936 2R 12163860..12163922 24..86 315 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:54:22 has no hits.

BO34404.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:51:39 Download gff for BO34404.complete
Subject Subject Range Query Range Percent Splice Strand
CG13177-RA 118..387 17..288 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:37:14 Download gff for BO34404.complete
Subject Subject Range Query Range Percent Splice Strand
CG13177-RA 118..387 17..288 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:37:14 Download gff for BO34404.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12163860..12163921 24..85 100 -> Plus
2R 12163984..12164184 86..288 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:51:39 Download gff for BO34404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8051365..8051426 24..85 100 -> Plus
arm_2R 8051489..8051689 86..288 99   Plus

BO34404.pep Sequence

Translation from 16 to 304

> BO34404.pep
MAKLFSILLCLAIIGFISAAPIEDKKPAEEADLSTADSIGYGYYAAPSPI
YYGGYGGGYKYGGYSGYGGYGGYRSYGGGFYRPRIYPVWGASFLDH

BO34404.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13177-PB 90 CG13177-PB 1..90 1..90 497 100 Plus
CG13177-PA 90 CG13177-PA 1..90 1..90 497 100 Plus
CG9269-PA 146 CG9269-PA 31..96 23..87 133 47.1 Plus