Clone BO34449 Report

Search the DGRC for BO34449

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:344
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG14752-RA
Protein status:BO34449.pep: Imported from assembly
Sequenced Size:370

Clone Sequence Records

BO34449.complete Sequence

370 bp assembled on 2013-09-16

GenBank Submission: KX799666

> BO34449.complete
GAAGTTATCAGTCGACATGTCCGTCCTGAAAGTATTCATCTTCGTCGCCC
TCTTCGCCGTGGCCTACTGCGCACCCAGTCCCGGCTTCTTTGGCAAACAC
GAGCACCACACCATCCACGTGCCCTACAAGGTGCACACGGTGCACCACCA
TCACGTTCAGAAGGTCCATGTGCCGGTGGTGAAGCACGTGCCGGTGCCCA
TTTACAAGGAGGTGCCCGTGCACCACGTCCACCACGAGGAGATCCCCGTG
CCGGTGCACCACGTCCATCACGAGGAGATCCCGGTGCACCATGTCTTCGA
TGACCACCACGACCACCACGGCTGGAGCTCCCACCACGGACACGGCTGGC
TGGCAAGCTTTCTAGACCAT

BO34449.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG14752-RA 339 CG14752-PA 1..336 17..352 1680 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14752-RA 540 CG14752-RA 73..409 16..352 1685 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8591565..8591817 100..352 1265 100 Plus
2R 25286936 2R 8591023..8591084 38..99 310 100 Plus
Blast to na_te.dros performed 2014-11-28 13:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
invader2 5124 invader2 INVADER2 5124bp 719..753 71..37 121 82.9 Minus

BO34449.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 11:50:01 Download gff for BO34449.complete
Subject Subject Range Query Range Percent Splice Strand
CG14752-RA 74..409 17..354 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:35:44 Download gff for BO34449.complete
Subject Subject Range Query Range Percent Splice Strand
CG14752-RA 74..409 17..354 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:35:44 Download gff for BO34449.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8590570..8590590 17..37 100 -> Plus
2R 8591023..8591084 38..99 100 -> Plus
2R 8591565..8591817 100..354 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 11:50:01 Download gff for BO34449.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4478075..4478095 17..37 100 -> Plus
arm_2R 4478528..4478589 38..99 100 -> Plus
arm_2R 4479070..4479322 100..354 99   Plus

BO34449.pep Sequence

Translation from 16 to 370

> BO34449.pep
MSVLKVFIFVALFAVAYCAPSPGFFGKHEHHTIHVPYKVHTVHHHHVQKV
HVPVVKHVPVPIYKEVPVHHVHHEEIPVPVHHVHHEEIPVHHVFDDHHDH
HGWSSHHGHGWLASFLDH

BO34449.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG14752-PA 112 CG14752-PA 1..112 1..112 662 100 Plus
CG14052-PB 163 CG14052-PB 7..114 3..107 150 36.3 Plus
CG13482-PA 102 CG13482-PA 22..97 26..109 140 40 Plus