Clone BO34466 Report

Search the DGRC for BO34466

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:344
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG42705-RA
Protein status:BO34466.pep: Imported from assembly
Sequenced Size:295

Clone Sequence Records

BO34466.complete Sequence

295 bp assembled on 2013-09-16

GenBank Submission: KX796947

> BO34466.complete
GAAGTTATCAGTCGACATGAAGATTTCCCTAGCCGTTCTTGGCCTCTTTT
TGGCTTTCTTCTTCAGTTCACAAACGCCAACATCAGCTTTTTTCCTTCCA
CCGCCATCGGATATTTTCTGCAAATATTACCCTAATTATATTTTTTGTGG
CAAAAATGATAATGACACTGGATCGGGAAACTCGACTTCACCTGCAACAC
CTGGAAATTCAACCAGCAATGGAACTACTCCAGCAGAAGGAGGCCAACCC
CGTTCTTTGACACCACCATTTGGTTATGCAAGCTTTCTAGACCAT

BO34466.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG42705-RA 264 CG42705-PA 1..261 17..277 1305 100 Plus
CG42705-RB 264 CG42705-PB 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG42705-RA 391 CG42705-RA 24..284 17..277 1305 100 Plus
CG42705-RB 740 CG42705-RB 24..284 17..277 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7414018..7414206 89..277 945 100 Plus
X 23542271 X 7413892..7413963 17..88 360 100 Plus
Blast to na_te.dros performed 2014-11-28 13:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
looper1 1881 looper1 LOOPER1_DM 1881bp 138..172 145..111 103 77.1 Minus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 1723..1761 144..107 102 76.9 Minus

BO34466.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:01:35 Download gff for BO34466.complete
Subject Subject Range Query Range Percent Splice Strand
CG42705-RA 24..284 17..279 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:37:22 Download gff for BO34466.complete
Subject Subject Range Query Range Percent Splice Strand
CG42705-RB 24..284 17..279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:37:22 Download gff for BO34466.complete
Subject Subject Range Query Range Percent Splice Strand
X 7413892..7413963 17..88 100 -> Plus
X 7414018..7414206 89..279 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:01:35 Download gff for BO34466.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7307925..7307996 17..88 100 -> Plus
arm_X 7308051..7308239 89..279 98   Plus

BO34466.pep Sequence

Translation from 16 to 295

> BO34466.pep
MKISLAVLGLFLAFFFSSQTPTSAFFLPPPSDIFCKYYPNYIFCGKNDND
TGSGNSTSPATPGNSTSNGTTPAEGGQPRSLTPPFGYASFLDH

BO34466.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42705-PA 87 CG42705-PA 1..87 1..87 474 100 Plus
CG42705-PB 87 CG42705-PB 1..87 1..87 474 100 Plus