BO34466.complete Sequence
295 bp assembled on 2013-09-16
GenBank Submission: KX796947
> BO34466.complete
GAAGTTATCAGTCGACATGAAGATTTCCCTAGCCGTTCTTGGCCTCTTTT
TGGCTTTCTTCTTCAGTTCACAAACGCCAACATCAGCTTTTTTCCTTCCA
CCGCCATCGGATATTTTCTGCAAATATTACCCTAATTATATTTTTTGTGG
CAAAAATGATAATGACACTGGATCGGGAAACTCGACTTCACCTGCAACAC
CTGGAAATTCAACCAGCAATGGAACTACTCCAGCAGAAGGAGGCCAACCC
CGTTCTTTGACACCACCATTTGGTTATGCAAGCTTTCTAGACCAT
BO34466.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:54:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42705-RA | 264 | CG42705-PA | 1..261 | 17..277 | 1305 | 100 | Plus |
CG42705-RB | 264 | CG42705-PB | 1..261 | 17..277 | 1305 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:54:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42705-RA | 391 | CG42705-RA | 24..284 | 17..277 | 1305 | 100 | Plus |
CG42705-RB | 740 | CG42705-RB | 24..284 | 17..277 | 1305 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:54:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7414018..7414206 | 89..277 | 945 | 100 | Plus |
X | 23542271 | X | 7413892..7413963 | 17..88 | 360 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 13:54:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
looper1 | 1881 | looper1 LOOPER1_DM 1881bp | 138..172 | 145..111 | 103 | 77.1 | Minus |
17.6 | 7439 | 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). | 1723..1761 | 144..107 | 102 | 76.9 | Minus |
BO34466.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:01:35 Download gff for
BO34466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42705-RA | 24..284 | 17..279 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:37:22 Download gff for
BO34466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42705-RB | 24..284 | 17..279 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:37:22 Download gff for
BO34466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7413892..7413963 | 17..88 | 100 | -> | Plus |
X | 7414018..7414206 | 89..279 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:01:35 Download gff for
BO34466.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 7307925..7307996 | 17..88 | 100 | -> | Plus |
arm_X | 7308051..7308239 | 89..279 | 98 | | Plus |
BO34466.pep Sequence
Translation from 16 to 295
> BO34466.pep
MKISLAVLGLFLAFFFSSQTPTSAFFLPPPSDIFCKYYPNYIFCGKNDND
TGSGNSTSPATPGNSTSNGTTPAEGGQPRSLTPPFGYASFLDH
BO34466.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42705-PA | 87 | CG42705-PA | 1..87 | 1..87 | 474 | 100 | Plus |
CG42705-PB | 87 | CG42705-PB | 1..87 | 1..87 | 474 | 100 | Plus |