Clone BO34502 Report

Search the DGRC for BO34502

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:345
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG30273-RA
Protein status:BO34502.pep: Imported from assembly
Sequenced Size:418

Clone Sequence Records

BO34502.complete Sequence

418 bp assembled on 2013-10-29

GenBank Submission: KX798756

> BO34502.complete
GAAGTTATCAGTCGACATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGG
GCTATCCCCACCAGATGCCCCCACCGAGCTATGAGCAGGTGGTGCACGTG
CAGGCGCCAGTTCGGGTGGTTCACCACACGACAGCACCTCCGCCCGTGGT
GATCATACAACATCAAGCTGTATTGCCGGTGGGTCCGGATCCCACCTTCA
TCACCTGCCCGCATTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCG
CCCAGTGTGAAAACTCACTGCATGGCCGCCATTCTATGCATCGTTGGCCT
CTGGTGTTGTGCCTGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCA
ATCACTTTTGCGGCAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT
GCAAGCTTTCTAGACCAT

BO34502.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG30273-RB 387 CG30273-PB 1..384 17..400 1920 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG30273-RB 1234 CG30273-RB 28..411 17..400 1920 100 Plus
CG30269-RB 1234 CG30269-RB 28..411 17..400 1920 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22667182..22667326 17..161 725 100 Plus
2R 25286936 2R 22667383..22667518 162..297 680 100 Plus
2R 25286936 2R 22667589..22667692 297..400 520 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:12:53 has no hits.

BO34502.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:45:33 Download gff for BO34502.complete
Subject Subject Range Query Range Percent Splice Strand
CG30273-RA 28..411 17..402 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:43:32 Download gff for BO34502.complete
Subject Subject Range Query Range Percent Splice Strand
CG30269-RB 28..411 17..402 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:43:32 Download gff for BO34502.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22667182..22667326 17..161 100 -> Plus
2R 22667383..22667518 162..297 100 -> Plus
2R 22667590..22667692 298..402 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:45:33 Download gff for BO34502.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18554687..18554831 17..161 100 -> Plus
arm_2R 18554888..18555023 162..297 100 -> Plus
arm_2R 18555095..18555197 298..402 98   Plus

BO34502.pep Sequence

Translation from 16 to 418

> BO34502.pep
MQYNQQPAGAPGYPHQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQHQ
AVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCAC
LPYCATSCMNANHFCGNCNKFVGVYNSDASFLDH

BO34502.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG30273-PB 128 CG30273-PB 1..128 1..128 737 100 Plus
CG30269-PB 144 CG30269-PB 23..142 11..126 286 42.9 Plus
CG30269-PA 144 CG30269-PA 23..142 11..126 286 42.9 Plus
CG13510-PC 129 CG13510-PC 4..129 16..127 263 41.3 Plus
CG13510-PB 129 CG13510-PB 4..129 16..127 263 41.3 Plus