Clone BO34519 Report

Search the DGRC for BO34519

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:345
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptCG43208-RA
Protein status:BO34519.pep: Imported from assembly
Sequenced Size:253

Clone Sequence Records

BO34519.complete Sequence

253 bp assembled on 2013-10-29

GenBank Submission: KX797964

> BO34519.complete
GAAGTTATCAGTCGACATGGGACACATGCAGGACAGGATTAAGGACTTGA
TCACCGCTGAGCGCGTGGCTATATTCTTTGGTCTATTATCGACCTGCTTG
ATCGTTGCCCTTGTCATTGTGGCCGTCCACAGGGATAATTTATTGCTGCA
GTTGGACGAAGCCAAAAGGATGTTGGATGTTCTGGAGGAATACATTCAAA
GCCACTTGTTGTCCACCATTTCGGAAAGAAATTCAGCAAGCTTTCTAGAC
CAT

BO34519.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG43208-RA 222 CG43208-PA 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG43208-RA 366 CG43208-RA 40..258 17..235 1095 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13303557..13303748 44..235 960 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:13:56 has no hits.

BO34519.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:45:55 Download gff for BO34519.complete
Subject Subject Range Query Range Percent Splice Strand
CG43208-RA 40..258 17..237 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:43:56 Download gff for BO34519.complete
Subject Subject Range Query Range Percent Splice Strand
CG43208-RA 40..258 17..237 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:43:56 Download gff for BO34519.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13303465..13303492 17..44 100 -> Plus
3R 13303558..13303748 45..237 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:45:55 Download gff for BO34519.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9129187..9129214 17..44 100 -> Plus
arm_3R 9129280..9129470 45..237 98   Plus

BO34519.pep Sequence

Translation from 16 to 253

> BO34519.pep
MGHMQDRIKDLITAERVAIFFGLLSTCLIVALVIVAVHRDNLLLQLDEAK
RMLDVLEEYIQSHLLSTISERNSASFLDH

BO34519.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG43208-PA 73 CG43208-PA 1..73 1..73 355 100 Plus