BO34519.complete Sequence
253 bp assembled on 2013-10-29
GenBank Submission: KX797964
> BO34519.complete
GAAGTTATCAGTCGACATGGGACACATGCAGGACAGGATTAAGGACTTGA
TCACCGCTGAGCGCGTGGCTATATTCTTTGGTCTATTATCGACCTGCTTG
ATCGTTGCCCTTGTCATTGTGGCCGTCCACAGGGATAATTTATTGCTGCA
GTTGGACGAAGCCAAAAGGATGTTGGATGTTCTGGAGGAATACATTCAAA
GCCACTTGTTGTCCACCATTTCGGAAAGAAATTCAGCAAGCTTTCTAGAC
CAT
BO34519.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:13:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43208-RA | 222 | CG43208-PA | 1..219 | 17..235 | 1095 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:13:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43208-RA | 366 | CG43208-RA | 40..258 | 17..235 | 1095 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:13:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 13303557..13303748 | 44..235 | 960 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:13:56 has no hits.
BO34519.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:45:55 Download gff for
BO34519.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43208-RA | 40..258 | 17..237 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:43:56 Download gff for
BO34519.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43208-RA | 40..258 | 17..237 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:43:56 Download gff for
BO34519.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13303465..13303492 | 17..44 | 100 | -> | Plus |
3R | 13303558..13303748 | 45..237 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:45:55 Download gff for
BO34519.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 9129187..9129214 | 17..44 | 100 | -> | Plus |
arm_3R | 9129280..9129470 | 45..237 | 98 | | Plus |
BO34519.pep Sequence
Translation from 16 to 253
> BO34519.pep
MGHMQDRIKDLITAERVAIFFGLLSTCLIVALVIVAVHRDNLLLQLDEAK
RMLDVLEEYIQSHLLSTISERNSASFLDH
BO34519.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43208-PA | 73 | CG43208-PA | 1..73 | 1..73 | 355 | 100 | Plus |