Clone BO34523 Report

Search the DGRC for BO34523

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:345
Well:23
Vector:pDNR-Dual
Associated Gene/TranscriptCG11286-RB
Protein status:BO34523.pep: Imported from assembly
Sequenced Size:340

Clone Sequence Records

BO34523.complete Sequence

340 bp assembled on 2013-10-29

GenBank Submission: KX799372

> BO34523.complete
GAAGTTATCAGTCGACATGTCCGCGACGAGCCTTGTAACCATTAAGTCGA
TCCCCTCAGCGGGAGATGTCCTGCGGGGTAAAAATGTACCAGTTCACCGC
CTCAACGCGAAGTTTGTGGCCAAGGCCCAGGAGAAGGCTAAGAAAGTGGA
GGAATTCCTGACTAGGACGAAGACCACTTCGTTGGTTTCCTTGTCAGGAC
TTGCTTCCCGATATGAGTTCCATCGTCTCCAGGAGCTCGACGAGTGGTAT
GAGCCAAGGATCAAGTTCCACGACGAGGCCGATGCCAGTTTGCATCCCAG
CTACGATATAAAGCACTTTCAGGCAAGCTTTCTAGACCAT

BO34523.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG11286-RB 309 CG11286-PB 1..306 17..322 1530 100 Plus
CG11286-RA 576 CG11286-PA 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG11286-RB 838 CG11286-RB 55..362 15..322 1540 100 Plus
CG11286-RA 779 CG11286-RA 55..362 15..322 1540 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7771395..7771702 322..15 1540 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:13:29 has no hits.

BO34523.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:45:46 Download gff for BO34523.complete
Subject Subject Range Query Range Percent Splice Strand
CG11286-RA 57..362 17..324 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:43:48 Download gff for BO34523.complete
Subject Subject Range Query Range Percent Splice Strand
CG11286-RA 57..362 17..324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:43:48 Download gff for BO34523.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7771393..7771700 17..324 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:45:46 Download gff for BO34523.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3597115..3597422 17..324 99   Minus

BO34523.pep Sequence

Translation from 16 to 340

> BO34523.pep
MSATSLVTIKSIPSAGDVLRGKNVPVHRLNAKFVAKAQEKAKKVEEFLTR
TKTTSLVSLSGLASRYEFHRLQELDEWYEPRIKFHDEADASLHPSYDIKH
FQASFLDH

BO34523.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG11286-PB 102 CG11286-PB 1..102 1..102 520 100 Plus
CG11286-PA 191 CG11286-PA 1..102 1..102 520 100 Plus