BO34527.complete Sequence
265 bp assembled on 2013-10-29
GenBank Submission: KX796045
> BO34527.complete
GAAGTTATCAGTCGACATGCTTAGTAATCCCTACTTTAAGTCCGTTTTGT
GGCTGATTGGCTTCGGAGGAATGGGGTACGGCCTAATGGTGTTAACCGAG
CCGAACGTCGACAAGTTAGAGCGCATCAAAGCCTCCGTTTCAAGTACCAA
ACTGAGTGCGGATGAGCAGCGAAAGGCTCTGTTTATGAAGAAGCTCCAGG
AGGCGTCCACCACCAGTGCCCCAATCTACAGGTCATCGTCCGAGAAAGCA
AGCTTTCTAGACCAT
BO34527.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:28:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15386-RA | 234 | CG15386-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:28:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42371-RA | 691 | CG42371-RA | 386..616 | 17..247 | 1155 | 100 | Plus |
CG15386-RA | 691 | CG15386-RA | 386..616 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:28:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2216578..2216808 | 247..17 | 1155 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 14:28:30 has no hits.
BO34527.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:03 Download gff for
BO34527.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15386-RA | 386..616 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:14:45 Download gff for
BO34527.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15386-RA | 386..616 | 17..249 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:14:45 Download gff for
BO34527.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2216576..2216808 | 17..249 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:03 Download gff for
BO34527.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2216576..2216808 | 17..249 | 99 | | Minus |
BO34527.pep Sequence
Translation from 16 to 265
> BO34527.pep
MLSNPYFKSVLWLIGFGGMGYGLMVLTEPNVDKLERIKASVSSTKLSADE
QRKALFMKKLQEASTTSAPIYRSSSEKASFLDH
BO34527.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15386-PA | 77 | CG15386-PA | 1..77 | 1..77 | 383 | 100 | Plus |