Clone BO34527 Report

Search the DGRC for BO34527

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:345
Well:27
Vector:pDNR-Dual
Associated Gene/TranscriptCG15386-RA
Protein status:BO34527.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO34527.complete Sequence

265 bp assembled on 2013-10-29

GenBank Submission: KX796045

> BO34527.complete
GAAGTTATCAGTCGACATGCTTAGTAATCCCTACTTTAAGTCCGTTTTGT
GGCTGATTGGCTTCGGAGGAATGGGGTACGGCCTAATGGTGTTAACCGAG
CCGAACGTCGACAAGTTAGAGCGCATCAAAGCCTCCGTTTCAAGTACCAA
ACTGAGTGCGGATGAGCAGCGAAAGGCTCTGTTTATGAAGAAGCTCCAGG
AGGCGTCCACCACCAGTGCCCCAATCTACAGGTCATCGTCCGAGAAAGCA
AGCTTTCTAGACCAT

BO34527.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG15386-RA 234 CG15386-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG42371-RA 691 CG42371-RA 386..616 17..247 1155 100 Plus
CG15386-RA 691 CG15386-RA 386..616 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2216578..2216808 247..17 1155 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:28:30 has no hits.

BO34527.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:03 Download gff for BO34527.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 386..616 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:14:45 Download gff for BO34527.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 386..616 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:14:45 Download gff for BO34527.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2216576..2216808 17..249 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:03 Download gff for BO34527.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2216576..2216808 17..249 99   Minus

BO34527.pep Sequence

Translation from 16 to 265

> BO34527.pep
MLSNPYFKSVLWLIGFGGMGYGLMVLTEPNVDKLERIKASVSSTKLSADE
QRKALFMKKLQEASTTSAPIYRSSSEKASFLDH

BO34527.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG15386-PA 77 CG15386-PA 1..77 1..77 383 100 Plus