Clone BO34535 Report

Search the DGRC for BO34535

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:345
Well:35
Vector:pDNR-Dual
Associated Gene/TranscriptCG44270-RA
Protein status:BO34535.pep: Imported from assembly
Sequenced Size:424

Clone Sequence Records

BO34535.complete Sequence

424 bp assembled on 2013-10-29

GenBank Submission: KX795321

> BO34535.complete
GAAGTTATCAGTCGACATGGAAACTTTGAACACGACCAAAATCCCACTAA
GTAAGTGTACGCCCAGTTCAGTTCGGTTTGGGTACCGGGAATATCCTCCG
AGGTTCCAGGTTAGCCCGGGTCCTCCATGCTCTCCATGTTCTCCTGGCTC
TCCGACAGGGTTCAGCTGCACCAGGTGTGCCCGTGCCCGGGTGTCTTCCA
CCTTTCGGTTTCCAGCCCCGAAACCGGAATCTACGATTGAATTTCAGACA
GTATACGGCATCCAGGCACCCAGGCACCCAACCACCCAAACCACCATCCG
GCGACCAAGGAAAACGCAAAGGCTTTTGCAATTTTTATGTGCAATTTTTT
ACATGAGAACCAAAGGCGGTACGAAGTGTCGCTTGTGGCTCGTTAAGGTT
AAGGGGGCAAGCTTTCTAGACCAT

BO34535.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG44270-RA 393 CG44270-PA 1..390 17..406 1950 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:14:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG44270-RA 712 CG44270-RA 112..501 17..406 1950 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20531388..20531622 172..406 1175 100 Plus
2L 23513712 2L 20531177..20531331 17..171 775 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:14:15 has no hits.

BO34535.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:01 Download gff for BO34535.complete
Subject Subject Range Query Range Percent Splice Strand
CG44270-RA 112..501 17..408 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:44:06 Download gff for BO34535.complete
Subject Subject Range Query Range Percent Splice Strand
CG44270-RA 112..501 17..408 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:44:06 Download gff for BO34535.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20531177..20531331 17..171 100 -> Plus
2L 20531388..20531622 172..408 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:01 Download gff for BO34535.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20531177..20531331 17..171 100 -> Plus
arm_2L 20531388..20531622 172..408 99   Plus

BO34535.pep Sequence

Translation from 16 to 424

> BO34535.pep
METLNTTKIPLSKCTPSSVRFGYREYPPRFQVSPGPPCSPCSPGSPTGFS
CTRCARARVSSTFRFPAPKPESTIEFQTVYGIQAPRHPTTQTTIRRPRKT
QRLLQFLCAIFYMRTKGGTKCRLWLVKVKGASFLDH

BO34535.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG44270-PA 130 CG44270-PA 1..130 1..130 710 100 Plus