Clone BO34541 Report

Search the DGRC for BO34541

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:345
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptCG43450-RA
Protein status:BO34541.pep: Imported from assembly
Sequenced Size:178

Clone Sequence Records

BO34541.complete Sequence

178 bp assembled on 2013-10-29

GenBank Submission: KX797758

> BO34541.complete
GAAGTTATCAGTCGACATGAATCTTAGGAGGACGCCCTGCCCCCAATTAA
ACACCACCGCAACCACAATGAAGAAATGTGTAATTGCCTGTTCGTCTTTC
GGTTCTCCGTCAACGTCGTGCTGCTCTCATTGGCCACGATTATTCTCATC
CTCCGCATGGGCAAGCTTTCTAGACCAT

BO34541.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG43450-RA 147 CG43450-PA 1..144 17..160 720 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG43450-RA 281 CG43450-RA 48..191 17..160 720 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12195341..12195484 17..160 720 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:28:59 has no hits.

BO34541.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:17 Download gff for BO34541.complete
Subject Subject Range Query Range Percent Splice Strand
CG43450-RA 48..191 17..162 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:14:55 Download gff for BO34541.complete
Subject Subject Range Query Range Percent Splice Strand
CG43450-RA 48..191 17..162 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:14:55 Download gff for BO34541.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12195341..12195484 17..162 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:17 Download gff for BO34541.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8021063..8021206 17..162 98   Plus

BO34541.pep Sequence

Translation from 16 to 178

> BO34541.pep
MNLRRTPCPQLNTTATTMKKCVIACSSFGSPSTSCCSHWPRLFSSSAWAS
FLDH

BO34541.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG43450-PA 48 CG43450-PA 1..48 1..48 271 100 Plus