BO34541.complete Sequence
178 bp assembled on 2013-10-29
GenBank Submission: KX797758
> BO34541.complete
GAAGTTATCAGTCGACATGAATCTTAGGAGGACGCCCTGCCCCCAATTAA
ACACCACCGCAACCACAATGAAGAAATGTGTAATTGCCTGTTCGTCTTTC
GGTTCTCCGTCAACGTCGTGCTGCTCTCATTGGCCACGATTATTCTCATC
CTCCGCATGGGCAAGCTTTCTAGACCAT
BO34541.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:29:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43450-RA | 147 | CG43450-PA | 1..144 | 17..160 | 720 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:29:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43450-RA | 281 | CG43450-RA | 48..191 | 17..160 | 720 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:28:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 12195341..12195484 | 17..160 | 720 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:28:59 has no hits.
BO34541.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:17 Download gff for
BO34541.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43450-RA | 48..191 | 17..162 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:14:55 Download gff for
BO34541.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43450-RA | 48..191 | 17..162 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:14:55 Download gff for
BO34541.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12195341..12195484 | 17..162 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:17 Download gff for
BO34541.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 8021063..8021206 | 17..162 | 98 | | Plus |
BO34541.pep Sequence
Translation from 16 to 178
> BO34541.pep
MNLRRTPCPQLNTTATTMKKCVIACSSFGSPSTSCCSHWPRLFSSSAWAS
FLDH
BO34541.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43450-PA | 48 | CG43450-PA | 1..48 | 1..48 | 271 | 100 | Plus |