BO34556.complete Sequence
286 bp assembled on 2013-10-29
GenBank Submission: KX796111
> BO34556.complete
GAAGTTATCAGTCGACATGCAGCACTACAACAACAACTACTACTACTATT
ACAACTACAACTTGAGCTATGAGCCGCCGGTCGATCGGTCGCTGGGCGGC
GGGGGCAAGCGGAGCATTCAACGTCTGCAGCAACTGGTGCGAAGGACGCG
GTACGAGCTGCAGCAATGGCCGCTACTGATGCAGCTGCTCCTGTTCGTCC
TTTGGCTAAATGCCAAGTTCTGGCAGCTGGTCAACGAACAGGTGACCTAC
CGCCGCAGGAGGTGGCACGCAAGCTTTCTAGACCAT
BO34556.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:11:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-RJ | 717 | CG3694-PJ | 463..714 | 17..268 | 1260 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:11:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-RJ | 2995 | CG3694-RJ | 1136..1387 | 17..268 | 1260 | 100 | Plus |
Ggamma30A-RI | 849 | CG3694-RI | 456..707 | 17..268 | 1260 | 100 | Plus |
Ggamma30A-RH | 4742 | CG3694-RH | 626..877 | 17..268 | 1260 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:11:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 9291405..9291656 | 17..268 | 1260 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:11:24 has no hits.
BO34556.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:45:03 Download gff for
BO34556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RH | 626..877 | 17..270 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:42:58 Download gff for
BO34556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RH | 626..877 | 17..270 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:42:58 Download gff for
BO34556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 9291405..9291656 | 17..270 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:45:03 Download gff for
BO34556.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 9291405..9291656 | 17..270 | 99 | | Plus |
BO34556.pep Sequence
Translation from 16 to 286
> BO34556.pep
MQHYNNNYYYYYNYNLSYEPPVDRSLGGGGKRSIQRLQQLVRRTRYELQQ
WPLLMQLLLFVLWLNAKFWQLVNEQVTYRRRRWHASFLDH
BO34556.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:51:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-PJ | 238 | CG3694-PJ | 155..238 | 1..84 | 467 | 100 | Plus |