Clone BO34556 Report

Search the DGRC for BO34556

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:345
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG43733-RA
Protein status:BO34556.pep: Imported from assembly
Sequenced Size:286

Clone Sequence Records

BO34556.complete Sequence

286 bp assembled on 2013-10-29

GenBank Submission: KX796111

> BO34556.complete
GAAGTTATCAGTCGACATGCAGCACTACAACAACAACTACTACTACTATT
ACAACTACAACTTGAGCTATGAGCCGCCGGTCGATCGGTCGCTGGGCGGC
GGGGGCAAGCGGAGCATTCAACGTCTGCAGCAACTGGTGCGAAGGACGCG
GTACGAGCTGCAGCAATGGCCGCTACTGATGCAGCTGCTCCTGTTCGTCC
TTTGGCTAAATGCCAAGTTCTGGCAGCTGGTCAACGAACAGGTGACCTAC
CGCCGCAGGAGGTGGCACGCAAGCTTTCTAGACCAT

BO34556.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-RJ 717 CG3694-PJ 463..714 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-RJ 2995 CG3694-RJ 1136..1387 17..268 1260 100 Plus
Ggamma30A-RI 849 CG3694-RI 456..707 17..268 1260 100 Plus
Ggamma30A-RH 4742 CG3694-RH 626..877 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9291405..9291656 17..268 1260 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:11:24 has no hits.

BO34556.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:45:03 Download gff for BO34556.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RH 626..877 17..270 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:42:58 Download gff for BO34556.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RH 626..877 17..270 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:42:58 Download gff for BO34556.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9291405..9291656 17..270 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:45:03 Download gff for BO34556.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9291405..9291656 17..270 99   Plus

BO34556.pep Sequence

Translation from 16 to 286

> BO34556.pep
MQHYNNNYYYYYNYNLSYEPPVDRSLGGGGKRSIQRLQQLVRRTRYELQQ
WPLLMQLLLFVLWLNAKFWQLVNEQVTYRRRRWHASFLDH

BO34556.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-PJ 238 CG3694-PJ 155..238 1..84 467 100 Plus