Clone BO34569 Report

Search the DGRC for BO34569

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:345
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptCG42511-RA
Protein status:BO34569.pep: Imported from assembly
Sequenced Size:262

Clone Sequence Records

BO34569.complete Sequence

262 bp assembled on 2013-10-29

GenBank Submission: KX799023

> BO34569.complete
GAAGTTATCAGTCGACATGTCCTCAGTGGAGGCCGAGGTGCTGCAGAAAA
TCGATCTGATTGAGCCCACAACCGGAAAATTGTTTTTCGAGCACAAAACG
GAGCTGCTTTTCTGCCGGCCACATCTGATGCCGCTAAAGACGCAGGCGCT
GGAACGCCTGGAGGAAATGCATCGGGACACCGCTCGCCAATTGCAGAAGA
AGCGCCAGCAGAAGAAGAAGTCCACGGAGCCCACAGGCTCGCTAGCAAGC
TTTCTAGACCAT

BO34569.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42511-RA 231 CG42511-PA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG42511-RA 2767 CG42511-RA 163..390 17..244 1140 100 Plus
CG8135-RA 2767 CG8135-RA 163..390 17..244 1140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9404547..9404774 17..244 1140 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:11:51 has no hits.

BO34569.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:45:09 Download gff for BO34569.complete
Subject Subject Range Query Range Percent Splice Strand
CG8135-RA 163..390 17..246 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:43:07 Download gff for BO34569.complete
Subject Subject Range Query Range Percent Splice Strand
CG8135-RA 163..390 17..246 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:43:07 Download gff for BO34569.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9404547..9404774 17..246 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:45:09 Download gff for BO34569.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5230269..5230496 17..246 99   Plus

BO34569.pep Sequence

Translation from 16 to 262

> BO34569.pep
MSSVEAEVLQKIDLIEPTTGKLFFEHKTELLFCRPHLMPLKTQALERLEE
MHRDTARQLQKKRQQKKKSTEPTGSLASFLDH

BO34569.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG42511-PA 76 CG42511-PA 1..76 1..76 386 100 Plus