BO34569.complete Sequence
262 bp assembled on 2013-10-29
GenBank Submission: KX799023
> BO34569.complete
GAAGTTATCAGTCGACATGTCCTCAGTGGAGGCCGAGGTGCTGCAGAAAA
TCGATCTGATTGAGCCCACAACCGGAAAATTGTTTTTCGAGCACAAAACG
GAGCTGCTTTTCTGCCGGCCACATCTGATGCCGCTAAAGACGCAGGCGCT
GGAACGCCTGGAGGAAATGCATCGGGACACCGCTCGCCAATTGCAGAAGA
AGCGCCAGCAGAAGAAGAAGTCCACGGAGCCCACAGGCTCGCTAGCAAGC
TTTCTAGACCAT
BO34569.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:11:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42511-RA | 231 | CG42511-PA | 1..228 | 17..244 | 1140 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:11:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42511-RA | 2767 | CG42511-RA | 163..390 | 17..244 | 1140 | 100 | Plus |
CG8135-RA | 2767 | CG8135-RA | 163..390 | 17..244 | 1140 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:11:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 9404547..9404774 | 17..244 | 1140 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:11:51 has no hits.
BO34569.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:45:09 Download gff for
BO34569.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8135-RA | 163..390 | 17..246 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:43:07 Download gff for
BO34569.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8135-RA | 163..390 | 17..246 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:43:07 Download gff for
BO34569.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 9404547..9404774 | 17..246 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:45:09 Download gff for
BO34569.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 5230269..5230496 | 17..246 | 99 | | Plus |
BO34569.pep Sequence
Translation from 16 to 262
> BO34569.pep
MSSVEAEVLQKIDLIEPTTGKLFFEHKTELLFCRPHLMPLKTQALERLEE
MHRDTARQLQKKRQQKKKSTEPTGSLASFLDH
BO34569.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42511-PA | 76 | CG42511-PA | 1..76 | 1..76 | 386 | 100 | Plus |