Clone BO34594 Report

Search the DGRC for BO34594

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:345
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptCG43173-RA
Protein status:BO34594.pep: Imported from assembly
Sequenced Size:247

Clone Sequence Records

BO34594.complete Sequence

247 bp assembled on 2013-10-29

GenBank Submission: KX795144

> BO34594.complete
GAAGTTATCAGTCGACATGTATGTATGTATGTCCAATATATATGTCCAAG
AGTCGGGGCCAGTTCAACAAACCCCATTGAACTCAATCCGGAGCAATGAC
ACCTCGCCGGGCCCTACAATCCGCACTCAACCTCACTTTCTTTTACGTGC
ATATGTCCATCCCTGTCATCCAAACATCTCTCTCTCCCTCTTGCACCCTT
TGGCCGTTGAGGGGCTTACGGTTGTCTTAGCAAGCTTTCTAGACCAT

BO34594.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 14:12:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 14:12:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17935172..17935384 17..229 1065 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:12:35 has no hits.

BO34594.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:45:26 Download gff for BO34594.complete
Subject Subject Range Query Range Percent Splice Strand
CG43173-RA 767..979 17..231 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:43:25 Download gff for BO34594.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17935172..17935384 17..231 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:43:25 Download gff for BO34594.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17935172..17935384 17..231 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:45:26 Download gff for BO34594.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17928272..17928484 17..231 99   Plus

BO34594.pep Sequence

Translation from 16 to 247

> BO34594.pep
MYVCMSNIYVQESGPVQQTPLNSIRSNDTSPGPTIRTQPHFLLRAYVHPC
HPNISLSLLHPLAVEGLTVVLASFLDH
Sequence BO34594.pep has no blast hits.