Clone BO34750 Report

Search the DGRC for BO34750

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:50
Vector:pDNR-Dual
Associated Gene/Transcripttau-RE
Protein status:BO34750.pep: Imported from assembly
Sequenced Size:313

Clone Sequence Records

BO34750.complete Sequence

313 bp assembled on 2013-10-29

GenBank Submission: KX794476

> BO34750.complete
GAAGTTATCAGTCGACATGGCGGATGTCCTGGAGAAAAGCTCACTGCTGG
ATGCTGTGCCACCACTAGGCGACCCCCACCCACCGCTGCCCCACCAGCAG
CTGCAACAGGAAGCAGCAGCAGCAGCAGCAGCAAATGCCGCACCACCAGC
ACCACCGCAGCAGCAACAACCACCACCCCATCAGCTGCAGCAGCAGCAGC
CGCAACAACAGCAACTGCAACAGAAGCCAGCAAATGCGAGGGCTAATCAG
GATCAAAAAGAATCGTCAGGAAATCAAACTAATTCAGTCCTAGAGGCAAG
CTTTCTAGACCAT

BO34750.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
tau-RE 282 CG45110-PE 1..279 17..295 1395 100 Plus
tau-RM 1104 CG45110-PM 1..245 17..261 1225 100 Plus
tau-RJ 927 CG45110-PJ 1..245 17..261 1225 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
tau-RE 1343 CG45110-RE 347..625 17..295 1395 100 Plus
tau-RM 2261 CG45110-RM 366..610 17..261 1225 100 Plus
tau-RJ 2084 CG45110-RJ 366..610 17..261 1225 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27656206..27656449 260..17 1220 100 Minus
3R 32079331 3R 27651572..27651610 295..257 195 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:31:01 has no hits.

BO34750.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:58 Download gff for BO34750.complete
Subject Subject Range Query Range Percent Splice Strand
tau-RE 347..625 17..297 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:15:47 Download gff for BO34750.complete
Subject Subject Range Query Range Percent Splice Strand
tau-RE 347..625 17..297 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:15:47 Download gff for BO34750.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27651570..27651606 261..297 94 <- Minus
3R 27656206..27656449 17..260 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:58 Download gff for BO34750.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23477292..23477328 261..297 94 <- Minus
arm_3R 23481928..23482171 17..260 100   Minus

BO34750.pep Sequence

Translation from 16 to 313

> BO34750.pep
MADVLEKSSLLDAVPPLGDPHPPLPHQQLQQEAAAAAAANAAPPAPPQQQ
QPPPHQLQQQQPQQQQLQQKPANARANQDQKESSGNQTNSVLEASFLDH

BO34750.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
tau-PE 93 CG45110-PE 1..93 1..93 483 100 Plus
tau-PH 288 CG45110-PH 1..86 1..86 431 95.3 Plus
tau-PJ 308 CG45110-PJ 1..86 1..86 431 95.3 Plus
tau-PC 349 CG45110-PC 1..86 1..86 431 95.3 Plus
tau-PI 350 CG45110-PI 1..86 1..86 431 95.3 Plus