Clone BO34757 Report

Search the DGRC for BO34757

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:57
Vector:pDNR-Dual
Associated Gene/Transcriptpes-RE
Protein status:BO34757.pep: Imported from assembly
Sequenced Size:295

Clone Sequence Records

BO34757.complete Sequence

295 bp assembled on 2013-10-29

GenBank Submission: KX795788

> BO34757.complete
GAAGTTATCAGTCGACATGACATCACGGACGCGCCACTGTGCCCGACTGG
GGATCGTTCTCCTTGGGATCTGTTGCATCGCCAGCGGAATTTACCTCTTC
CGCAACTGGATCGATATGTTTACACGCATGCGCGGCCAGACCTTTGGGTT
AAGTTTCGCAAGCCGGCAAATTGGCAATGTGTGCAGAGGTCAACTGGGAG
ACTCATTTGCATACCACTTGGATTGGGAGGCAACAATTTTTTCCATTGAT
TTAAAGCAAAGACGAACGCAAAGACACGCAAGCTTTCTAGACCAT

BO34757.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
pes-RE 264 CG7228-PE 1..261 17..277 1305 100 Plus
pes-RF 1668 CG7228-PF 1..123 17..139 615 100 Plus
pes-RH 1668 CG7228-PH 1..123 17..139 615 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
pes-RE 519 CG7228-RE 101..361 17..277 1305 100 Plus
pes-RF 2532 CG7228-RF 101..223 17..139 615 100 Plus
pes-RH 2653 CG7228-RH 222..344 17..139 615 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7991122..7991262 277..137 705 100 Minus
2L 23513712 2L 7991358..7991480 139..17 615 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:31:23 has no hits.

BO34757.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:08 Download gff for BO34757.complete
Subject Subject Range Query Range Percent Splice Strand
pes-RE 101..361 17..279 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:00 Download gff for BO34757.complete
Subject Subject Range Query Range Percent Splice Strand
pes-RE 101..361 17..279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:00 Download gff for BO34757.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7991119..7991259 140..279 98 <- Minus
2L 7991358..7991480 17..139 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:08 Download gff for BO34757.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7991119..7991259 140..279 98 <- Minus
arm_2L 7991358..7991480 17..139 100   Minus

BO34757.pep Sequence

Translation from 16 to 295

> BO34757.pep
MTSRTRHCARLGIVLLGICCIASGIYLFRNWIDMFTRMRGQTFGLSFASR
QIGNVCRGQLGDSFAYHLDWEATIFSIDLKQRRTQRHASFLDH

BO34757.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
pes-PE 87 CG7228-PE 1..87 1..87 467 100 Plus
pes-PF 555 CG7228-PF 1..50 1..50 232 90 Plus
pes-PH 555 CG7228-PH 1..50 1..50 232 90 Plus
pes-PG 555 CG7228-PG 1..50 1..50 232 90 Plus
pes-PD 555 CG7228-PD 1..50 1..50 232 90 Plus