Clone BO34759 Report

Search the DGRC for BO34759

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:59
Vector:pDNR-Dual
Associated Gene/TranscriptCG43168-RA
Protein status:BO34759.pep: Imported from assembly
Sequenced Size:286

Clone Sequence Records

BO34759.complete Sequence

286 bp assembled on 2013-10-29

GenBank Submission: KX798576

> BO34759.complete
GAAGTTATCAGTCGACATGAGCGGGTCGAATCCGTCCAATTCCAGGAGGG
CCAATTATCGCAATACCTTGGATCCGGATATGGTTAGCAGAATCGAGCAA
CTCGAGCAGTTACTGGAGACCGAAAAACGGAAGTATCATCAATTGTCCAT
GGATCGACTTTTAAATTACAAATTGGATCGGGATAACCTGCCGGAGGATA
CTCCGTTGCCAATATACCTGGCCCATCGGGAGCCCAGAAGTTTGAGTCCA
CCAAGCCGGTGGGACGCCGCAAGCTTTCTAGACCAT

BO34759.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG43168-RA 255 CG43168-PA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG43168-RA 1078 CG43168-RA 41..292 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6275827..6276078 17..268 1260 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:30:53 has no hits.

BO34759.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:56 Download gff for BO34759.complete
Subject Subject Range Query Range Percent Splice Strand
CG43168-RA 41..292 17..270 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:15:43 Download gff for BO34759.complete
Subject Subject Range Query Range Percent Splice Strand
CG43168-RA 41..292 17..270 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:15:43 Download gff for BO34759.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6275827..6276078 17..270 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:56 Download gff for BO34759.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6268927..6269178 17..270 99   Plus

BO34759.pep Sequence

Translation from 16 to 286

> BO34759.pep
MSGSNPSNSRRANYRNTLDPDMVSRIEQLEQLLETEKRKYHQLSMDRLLN
YKLDRDNLPEDTPLPIYLAHREPRSLSPPSRWDAASFLDH

BO34759.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG43168-PA 84 CG43168-PA 1..84 1..84 443 100 Plus