BO34760.complete Sequence
211 bp assembled on 2013-10-29
GenBank Submission: KX799882
> BO34760.complete
GAAGTTATCAGTCGACATGTTCACCTTCTGCCATGTTTGCCAACCCTCCT
TGGAAGTCGGGGGACTCCTCCTAATGACTCGGAATATGTTTTGCCGTATT
CGTAGCATTAACATTCCTTCGCAGCCGAAAATGTCTTCAGAACATATAGT
GGATGTTGCGCAAACAGGCTTAAGTAGAACTCATCCGAGTAAGGCAAGCT
TTCTAGACCAT
BO34760.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:30:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43401-RA | 180 | CG43401-PA | 1..177 | 17..193 | 885 | 100 | Plus |
CG43401-RB | 180 | CG43401-PB | 1..177 | 17..193 | 885 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:30:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43401-RA | 508 | CG43401-RA | 195..371 | 17..193 | 885 | 100 | Plus |
CG43401-RB | 686 | CG43401-RB | 195..371 | 17..193 | 885 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:30:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 1428668..1428844 | 17..193 | 885 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:30:57 has no hits.
BO34760.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:57 Download gff for
BO34760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43401-RB | 200..371 | 22..195 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:15:45 Download gff for
BO34760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43401-RB | 200..371 | 22..195 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:15:45 Download gff for
BO34760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 1428673..1428844 | 22..195 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:57 Download gff for
BO34760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 1428673..1428844 | 22..195 | 98 | | Plus |
BO34760.pep Sequence
Translation from 16 to 211
> BO34760.pep
MFTFCHVCQPSLEVGGLLLMTRNMFCRIRSINIPSQPKMSSEHIVDVAQT
GLSRTHPSKASFLDH
BO34760.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43401-PA | 59 | CG43401-PA | 1..59 | 1..59 | 312 | 100 | Plus |
CG43401-PB | 59 | CG43401-PB | 1..59 | 1..59 | 312 | 100 | Plus |