Clone BO34760 Report

Search the DGRC for BO34760

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptCG43401-RA
Protein status:BO34760.pep: Imported from assembly
Sequenced Size:211

Clone Sequence Records

BO34760.complete Sequence

211 bp assembled on 2013-10-29

GenBank Submission: KX799882

> BO34760.complete
GAAGTTATCAGTCGACATGTTCACCTTCTGCCATGTTTGCCAACCCTCCT
TGGAAGTCGGGGGACTCCTCCTAATGACTCGGAATATGTTTTGCCGTATT
CGTAGCATTAACATTCCTTCGCAGCCGAAAATGTCTTCAGAACATATAGT
GGATGTTGCGCAAACAGGCTTAAGTAGAACTCATCCGAGTAAGGCAAGCT
TTCTAGACCAT

BO34760.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG43401-RA 180 CG43401-PA 1..177 17..193 885 100 Plus
CG43401-RB 180 CG43401-PB 1..177 17..193 885 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG43401-RA 508 CG43401-RA 195..371 17..193 885 100 Plus
CG43401-RB 686 CG43401-RB 195..371 17..193 885 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1428668..1428844 17..193 885 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:30:57 has no hits.

BO34760.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:57 Download gff for BO34760.complete
Subject Subject Range Query Range Percent Splice Strand
CG43401-RB 200..371 22..195 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:15:45 Download gff for BO34760.complete
Subject Subject Range Query Range Percent Splice Strand
CG43401-RB 200..371 22..195 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:15:45 Download gff for BO34760.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1428673..1428844 22..195 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:57 Download gff for BO34760.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1428673..1428844 22..195 98   Plus

BO34760.pep Sequence

Translation from 16 to 211

> BO34760.pep
MFTFCHVCQPSLEVGGLLLMTRNMFCRIRSINIPSQPKMSSEHIVDVAQT
GLSRTHPSKASFLDH

BO34760.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG43401-PA 59 CG43401-PA 1..59 1..59 312 100 Plus
CG43401-PB 59 CG43401-PB 1..59 1..59 312 100 Plus