BO34761.complete Sequence
268 bp assembled on 2013-10-29
GenBank Submission: KX798901
> BO34761.complete
GAAGTTATCAGTCGACATGAACAATCTGTGGCGCGAAATCGGCTTTATTA
CCAAGCGAAGGCCGAAGAAACATGTGAAAATCATTCGGATCAAGAAACGC
GTTGCCAAATCGAAGAAAGTCTTCAAGCGAAGGCAATATGAACTGATACA
ACTTCATTTGAGAAATCGTATAAAGTATTTAATTATCGAAAATCTGGAGC
AAGCCTTGGCAAAAATCCAAACTAAGAAAGGGATTCAGAAGAGCTTAAAG
GCAAGCTTTCTAGACCAT
BO34761.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:31:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43449-RB | 237 | CG43449-PB | 1..234 | 17..250 | 1170 | 100 | Plus |
CG43449-RA | 237 | CG43449-PA | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:31:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43449-RB | 937 | CG43449-RB | 19..252 | 17..250 | 1170 | 100 | Plus |
CG43449-RA | 514 | CG43449-RA | 19..252 | 17..250 | 1170 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:31:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 11088438..11088671 | 17..250 | 1170 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 14:31:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
accord2 | 7650 | accord2 QBERT 7650bp | 1200..1232 | 167..135 | 102 | 78.8 | Minus |
BO34761.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:11 Download gff for
BO34761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43449-RA | 19..252 | 17..252 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:02 Download gff for
BO34761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43449-RA | 19..252 | 17..252 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:02 Download gff for
BO34761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 11088438..11088671 | 17..252 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:11 Download gff for
BO34761.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 6914160..6914393 | 17..252 | 99 | | Plus |
BO34761.pep Sequence
Translation from 16 to 268
> BO34761.pep
MNNLWREIGFITKRRPKKHVKIIRIKKRVAKSKKVFKRRQYELIQLHLRN
RIKYLIIENLEQALAKIQTKKGIQKSLKASFLDH
BO34761.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43449-PB | 78 | CG43449-PB | 1..78 | 1..78 | 389 | 100 | Plus |
CG43449-PA | 78 | CG43449-PA | 1..78 | 1..78 | 389 | 100 | Plus |