Clone BO34761 Report

Search the DGRC for BO34761

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptCG43449-RA
Protein status:BO34761.pep: Imported from assembly
Sequenced Size:268

Clone Sequence Records

BO34761.complete Sequence

268 bp assembled on 2013-10-29

GenBank Submission: KX798901

> BO34761.complete
GAAGTTATCAGTCGACATGAACAATCTGTGGCGCGAAATCGGCTTTATTA
CCAAGCGAAGGCCGAAGAAACATGTGAAAATCATTCGGATCAAGAAACGC
GTTGCCAAATCGAAGAAAGTCTTCAAGCGAAGGCAATATGAACTGATACA
ACTTCATTTGAGAAATCGTATAAAGTATTTAATTATCGAAAATCTGGAGC
AAGCCTTGGCAAAAATCCAAACTAAGAAAGGGATTCAGAAGAGCTTAAAG
GCAAGCTTTCTAGACCAT

BO34761.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:31:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG43449-RB 237 CG43449-PB 1..234 17..250 1170 100 Plus
CG43449-RA 237 CG43449-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG43449-RB 937 CG43449-RB 19..252 17..250 1170 100 Plus
CG43449-RA 514 CG43449-RA 19..252 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11088438..11088671 17..250 1170 100 Plus
Blast to na_te.dros performed 2014-11-28 14:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 1200..1232 167..135 102 78.8 Minus

BO34761.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:11 Download gff for BO34761.complete
Subject Subject Range Query Range Percent Splice Strand
CG43449-RA 19..252 17..252 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:02 Download gff for BO34761.complete
Subject Subject Range Query Range Percent Splice Strand
CG43449-RA 19..252 17..252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:02 Download gff for BO34761.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11088438..11088671 17..252 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:11 Download gff for BO34761.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6914160..6914393 17..252 99   Plus

BO34761.pep Sequence

Translation from 16 to 268

> BO34761.pep
MNNLWREIGFITKRRPKKHVKIIRIKKRVAKSKKVFKRRQYELIQLHLRN
RIKYLIIENLEQALAKIQTKKGIQKSLKASFLDH

BO34761.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG43449-PB 78 CG43449-PB 1..78 1..78 389 100 Plus
CG43449-PA 78 CG43449-PA 1..78 1..78 389 100 Plus