Clone BO34764 Report

Search the DGRC for BO34764

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG43407-RA
Protein status:BO34764.pep: Imported from assembly
Sequenced Size:163

Clone Sequence Records

BO34764.complete Sequence

163 bp assembled on 2013-10-29

GenBank Submission: KX798513

> BO34764.complete
GAAGTTATCAGTCGACATGGGCGAATGTGTGAGGTGGCCGCCTGCGGACC
GGGCTGAAATGAACATGCACACATGCTGGCGAAGGGGCGGAGAAAATTTC
AGAGGAGGGGGAGTGCCCAGAGCAGGAGGATCGGGTCTGTCCAGCGCAAG
CTTTCTAGACCAT

BO34764.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG43407-RA 132 CG43407-PA 1..129 17..145 645 100 Plus
CG43407-RB 132 CG43407-PB 1..129 17..145 645 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG43407-RA 368 CG43407-RA 93..221 17..145 645 100 Plus
CG43407-RB 488 CG43407-RB 93..221 17..145 645 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19053169..19053297 145..17 645 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:31:37 has no hits.

BO34764.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:15 Download gff for BO34764.complete
Subject Subject Range Query Range Percent Splice Strand
CG43407-RB 93..221 17..147 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:07 Download gff for BO34764.complete
Subject Subject Range Query Range Percent Splice Strand
CG43407-RB 93..221 17..147 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:07 Download gff for BO34764.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19053167..19053297 17..147 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:15 Download gff for BO34764.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19046267..19046397 17..147 98   Minus

BO34764.pep Sequence

Translation from 16 to 163

> BO34764.pep
MGECVRWPPADRAEMNMHTCWRRGGENFRGGGVPRAGGSGLSSASFLDH

BO34764.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG43407-PA 43 CG43407-PA 1..43 1..43 248 100 Plus
CG43407-PB 43 CG43407-PB 1..43 1..43 248 100 Plus