BO34764.complete Sequence
163 bp assembled on 2013-10-29
GenBank Submission: KX798513
> BO34764.complete
GAAGTTATCAGTCGACATGGGCGAATGTGTGAGGTGGCCGCCTGCGGACC
GGGCTGAAATGAACATGCACACATGCTGGCGAAGGGGCGGAGAAAATTTC
AGAGGAGGGGGAGTGCCCAGAGCAGGAGGATCGGGTCTGTCCAGCGCAAG
CTTTCTAGACCAT
BO34764.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:31:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43407-RA | 132 | CG43407-PA | 1..129 | 17..145 | 645 | 100 | Plus |
CG43407-RB | 132 | CG43407-PB | 1..129 | 17..145 | 645 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:31:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43407-RA | 368 | CG43407-RA | 93..221 | 17..145 | 645 | 100 | Plus |
CG43407-RB | 488 | CG43407-RB | 93..221 | 17..145 | 645 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:31:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 19053169..19053297 | 145..17 | 645 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 14:31:37 has no hits.
BO34764.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:15 Download gff for
BO34764.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43407-RB | 93..221 | 17..147 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:07 Download gff for
BO34764.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43407-RB | 93..221 | 17..147 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:07 Download gff for
BO34764.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 19053167..19053297 | 17..147 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:15 Download gff for
BO34764.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 19046267..19046397 | 17..147 | 98 | | Minus |
BO34764.pep Sequence
Translation from 16 to 163
> BO34764.pep
MGECVRWPPADRAEMNMHTCWRRGGENFRGGGVPRAGGSGLSSASFLDH
BO34764.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43407-PA | 43 | CG43407-PA | 1..43 | 1..43 | 248 | 100 | Plus |
CG43407-PB | 43 | CG43407-PB | 1..43 | 1..43 | 248 | 100 | Plus |