Clone BO34765 Report

Search the DGRC for BO34765

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG43447-RA
Protein status:BO34765.pep: Imported from assembly
Sequenced Size:229

Clone Sequence Records

BO34765.complete Sequence

229 bp assembled on 2013-10-29

GenBank Submission: KX799413

> BO34765.complete
GAAGTTATCAGTCGACATGGGGGCGTGCCCCGGACAGCCGTGCTTTGGCG
CTCAATTAAAACGGAACCAAAGTCAAAAGTCACCGAGCGATATGGGAAGC
CCACGGAGTCCTAGTTCTAGCTGCGATGGATTAACACATCTCCCGGGGCA
ACATCTCTCCCGGCGACAACCCTCATGGCAAGGTCTTTTGCTCGAAGGCT
GGCCTGTCATAGCAAGCTTTCTAGACCAT

BO34765.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG43447-RA 198 CG43447-PA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG43447-RA 534 CG43447-RA 96..290 17..211 975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27440407..27440601 17..211 975 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:31:40 has no hits.

BO34765.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:17 Download gff for BO34765.complete
Subject Subject Range Query Range Percent Splice Strand
CG43447-RA 96..290 17..213 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:10 Download gff for BO34765.complete
Subject Subject Range Query Range Percent Splice Strand
CG43447-RA 96..290 17..213 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:10 Download gff for BO34765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27440407..27440601 17..213 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:17 Download gff for BO34765.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23266129..23266323 17..213 98   Plus

BO34765.pep Sequence

Translation from 16 to 229

> BO34765.pep
MGACPGQPCFGAQLKRNQSQKSPSDMGSPRSPSSSCDGLTHLPGQHLSRR
QPSWQGLLLEGWPVIASFLDH

BO34765.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG43447-PA 65 CG43447-PA 1..65 1..65 362 100 Plus