BO34765.complete Sequence
229 bp assembled on 2013-10-29
GenBank Submission: KX799413
> BO34765.complete
GAAGTTATCAGTCGACATGGGGGCGTGCCCCGGACAGCCGTGCTTTGGCG
CTCAATTAAAACGGAACCAAAGTCAAAAGTCACCGAGCGATATGGGAAGC
CCACGGAGTCCTAGTTCTAGCTGCGATGGATTAACACATCTCCCGGGGCA
ACATCTCTCCCGGCGACAACCCTCATGGCAAGGTCTTTTGCTCGAAGGCT
GGCCTGTCATAGCAAGCTTTCTAGACCAT
BO34765.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:31:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43447-RA | 198 | CG43447-PA | 1..195 | 17..211 | 975 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:31:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43447-RA | 534 | CG43447-RA | 96..290 | 17..211 | 975 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:31:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 27440407..27440601 | 17..211 | 975 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:31:40 has no hits.
BO34765.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:17 Download gff for
BO34765.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43447-RA | 96..290 | 17..213 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:10 Download gff for
BO34765.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43447-RA | 96..290 | 17..213 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:10 Download gff for
BO34765.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 27440407..27440601 | 17..213 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:17 Download gff for
BO34765.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 23266129..23266323 | 17..213 | 98 | | Plus |
BO34765.pep Sequence
Translation from 16 to 229
> BO34765.pep
MGACPGQPCFGAQLKRNQSQKSPSDMGSPRSPSSSCDGLTHLPGQHLSRR
QPSWQGLLLEGWPVIASFLDH
BO34765.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43447-PA | 65 | CG43447-PA | 1..65 | 1..65 | 362 | 100 | Plus |