BO34768.complete Sequence
199 bp assembled on 2013-10-29
GenBank Submission: KX799335
> BO34768.complete
GAAGTTATCAGTCGACATGTTGACGCTTACACTTGGATTTGCGATGCAGT
TGCTGCTGTTGATTTCGCTGCTACTGCTACTTCCACTGCCCGGATTTTCG
AGAGAACTAAGGCAGCCCTATAGATACGACAGATACGACGGTAATCCTGG
CCAAAACCAACCAAGGAATTTGGAGCGGAACGCAAGCTTTCTAGACCAT
BO34768.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:31:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43351-RA | 168 | CG43351-PA | 1..165 | 17..181 | 825 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:31:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43351-RA | 242 | CG43351-RA | 14..178 | 17..181 | 825 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:31:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 19030022..19030186 | 17..181 | 825 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 14:31:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
roo | 9092 | roo DM_ROO 9092bp | 1084..1135 | 89..39 | 122 | 73.1 | Minus |
roo | 9092 | roo DM_ROO 9092bp | 1099..1153 | 89..33 | 118 | 72.4 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6814..6885 | 89..18 | 117 | 62.5 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2326..2386 | 78..18 | 116 | 65.6 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2347..2393 | 78..33 | 115 | 74.5 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2783..2823 | 83..43 | 106 | 73.2 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6712..6770 | 101..43 | 106 | 64.4 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2306..2340 | 77..43 | 103 | 77.1 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2824..2887 | 81..18 | 103 | 66.2 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2626..2685 | 81..19 | 101 | 65.1 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6847..6892 | 83..39 | 101 | 71.7 | Minus |
roo | 9092 | roo DM_ROO 9092bp | 1105..1151 | 89..43 | 100 | 68.1 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2805..2842 | 76..39 | 100 | 73.7 | Minus |
BO34768.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:22 Download gff for
BO34768.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43351-RA | 19..178 | 22..183 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:15 Download gff for
BO34768.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43351-RA | 19..178 | 22..183 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:15 Download gff for
BO34768.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19030027..19030186 | 22..183 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:22 Download gff for
BO34768.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14917532..14917691 | 22..183 | 98 | | Plus |
BO34768.pep Sequence
Translation from 16 to 199
> BO34768.pep
MLTLTLGFAMQLLLLISLLLLLPLPGFSRELRQPYRYDRYDGNPGQNQPR
NLERNASFLDH
BO34768.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43351-PA | 55 | CG43351-PA | 1..55 | 1..55 | 284 | 100 | Plus |