Clone BO34773 Report

Search the DGRC for BO34773

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG43250-RA
Protein status:BO34773.pep: Imported from assembly
Sequenced Size:253

Clone Sequence Records

BO34773.complete Sequence

253 bp assembled on 2013-10-29

GenBank Submission: KX799574

> BO34773.complete
GAAGTTATCAGTCGACATGATGACGCCCGATCCAGAACAACCGTTAAGTG
CTCCACCCCAAATGATGCTGCAACAGGGTGAGCGAAAGAGAGGGCGAGCC
CGATACCGAAAGAGACAGAGGCAGAGCCGAACAGAAACGACAGTGAAAGT
TCTACACTTTCGCTTTTTCACAGAACCCTGCTATCATACGAAAAGCAGCA
ATCGTAGAGATAGAAACCTTTGGAAATACAATACAGCAAGCTTTCTAGAC
CAT

BO34773.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 14:32:03 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 14:32:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17033391..17033609 235..17 1095 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:32:02 has no hits.

BO34773.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:25 Download gff for BO34773.complete
Subject Subject Range Query Range Percent Splice Strand
CG43250-RA 68..286 17..237 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:20 Download gff for BO34773.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17033389..17033609 17..237 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:20 Download gff for BO34773.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17033389..17033609 17..237 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:25 Download gff for BO34773.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17026489..17026709 17..237 99   Minus

BO34773.pep Sequence

Translation from 16 to 253

> BO34773.pep
MMTPDPEQPLSAPPQMMLQQGERKRGRARYRKRQRQSRTETTVKVLHFRF
FTEPCYHTKSSNRRDRNLWKYNTASFLDH
Sequence BO34773.pep has no blast hits.