Clone BO34775 Report

Search the DGRC for BO34775

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG43233-RA
Protein status:BO34775.pep: Imported from assembly
Sequenced Size:304

Clone Sequence Records

BO34775.complete Sequence

304 bp assembled on 2013-10-29

GenBank Submission: KX799326

> BO34775.complete
GAAGTTATCAGTCGACATGTGTGTGCGTCTCGTTGGATCCGCTCTCTGTT
GCTGTTGCAAATTGGGCCTCAAGTGCCTGTGCATCTTCGCCTGTTCCACG
GTCGGTGTTCTCGCCATAGTTGCCTTGGTCGTTTACTTTTGTTTCTTCCA
CAACAAATCGGAGGACTCGACCACAAAGTCTCTCTCTGATTCTACTATCG
ATAAGTCCTTGAAGGATAGCATAACTACTGCAACGGAAGCCCCTTCACTC
GTCAGAGGATATCTCCAACAAATGATAGAAAGAATCGCAAGCTTTCTAGA
CCAT

BO34775.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:32:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG43233-RA 273 CG43233-PA 1..270 17..286 1350 100 Plus
CG43233-RB 99 CG43233-PB 1..99 17..119 420 96.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:32:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG43233-RA 541 CG43233-RA 83..352 17..286 1350 100 Plus
CG43233-RB 537 CG43233-RB 83..348 17..286 1255 98.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20472982..20473217 286..51 1180 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:32:09 has no hits.

BO34775.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:27 Download gff for BO34775.complete
Subject Subject Range Query Range Percent Splice Strand
CG43233-RA 83..352 17..288 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:22 Download gff for BO34775.complete
Subject Subject Range Query Range Percent Splice Strand
CG43233-RA 83..352 17..288 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:22 Download gff for BO34775.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20472980..20473216 52..288 99 <- Minus
2L 20473269..20473303 17..51 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:27 Download gff for BO34775.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20472980..20473216 52..288 99 <- Minus
arm_2L 20473269..20473303 17..51 100   Minus

BO34775.pep Sequence

Translation from 16 to 304

> BO34775.pep
MCVRLVGSALCCCCKLGLKCLCIFACSTVGVLAIVALVVYFCFFHNKSED
STTKSLSDSTIDKSLKDSITTATEAPSLVRGYLQQMIERIASFLDH

BO34775.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG43233-PA 90 CG43233-PA 1..90 1..90 467 100 Plus