BO34775.complete Sequence
304 bp assembled on 2013-10-29
GenBank Submission: KX799326
> BO34775.complete
GAAGTTATCAGTCGACATGTGTGTGCGTCTCGTTGGATCCGCTCTCTGTT
GCTGTTGCAAATTGGGCCTCAAGTGCCTGTGCATCTTCGCCTGTTCCACG
GTCGGTGTTCTCGCCATAGTTGCCTTGGTCGTTTACTTTTGTTTCTTCCA
CAACAAATCGGAGGACTCGACCACAAAGTCTCTCTCTGATTCTACTATCG
ATAAGTCCTTGAAGGATAGCATAACTACTGCAACGGAAGCCCCTTCACTC
GTCAGAGGATATCTCCAACAAATGATAGAAAGAATCGCAAGCTTTCTAGA
CCAT
BO34775.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:32:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43233-RA | 273 | CG43233-PA | 1..270 | 17..286 | 1350 | 100 | Plus |
CG43233-RB | 99 | CG43233-PB | 1..99 | 17..119 | 420 | 96.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:32:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43233-RA | 541 | CG43233-RA | 83..352 | 17..286 | 1350 | 100 | Plus |
CG43233-RB | 537 | CG43233-RB | 83..348 | 17..286 | 1255 | 98.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 20472982..20473217 | 286..51 | 1180 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 14:32:09 has no hits.
BO34775.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:27 Download gff for
BO34775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43233-RA | 83..352 | 17..288 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:22 Download gff for
BO34775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43233-RA | 83..352 | 17..288 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:22 Download gff for
BO34775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 20472980..20473216 | 52..288 | 99 | <- | Minus |
2L | 20473269..20473303 | 17..51 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:27 Download gff for
BO34775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 20472980..20473216 | 52..288 | 99 | <- | Minus |
arm_2L | 20473269..20473303 | 17..51 | 100 | | Minus |
BO34775.pep Sequence
Translation from 16 to 304
> BO34775.pep
MCVRLVGSALCCCCKLGLKCLCIFACSTVGVLAIVALVVYFCFFHNKSED
STTKSLSDSTIDKSLKDSITTATEAPSLVRGYLQQMIERIASFLDH
BO34775.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43233-PA | 90 | CG43233-PA | 1..90 | 1..90 | 467 | 100 | Plus |