Clone BO34777 Report

Search the DGRC for BO34777

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG43230-RA
Protein status:BO34777.pep: Imported from assembly
Sequenced Size:202

Clone Sequence Records

BO34777.complete Sequence

202 bp assembled on 2013-10-29

GenBank Submission: KX794385

> BO34777.complete
GAAGTTATCAGTCGACATGCCTTTTAGTCTCTTCACTACCAGCATAGCTG
TAGCTGGTCGGCCTCCAAAGTTCAAGAGCTTTTCGGCAATAACTTTAAAT
AGAAGAGACCCATCTTGTGCCCAAATGGAATTCGGTGCGGCGAAAACCAC
GACGACAGGGTGGAAAACAAGAAACGGGCATCATGCAAGCTTTCTAGACC
AT

BO34777.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG43230-RA 171 CG43230-PA 1..168 17..184 840 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG43230-RA 799 CG43230-RA 141..309 16..184 845 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15215431..15215543 16..128 565 100 Plus
2L 23513712 2L 15215613..15215670 127..184 290 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:32:15 has no hits.

BO34777.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:30 Download gff for BO34777.complete
Subject Subject Range Query Range Percent Splice Strand
CG43230-RA 142..309 17..186 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:25 Download gff for BO34777.complete
Subject Subject Range Query Range Percent Splice Strand
CG43230-RA 142..309 17..186 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:25 Download gff for BO34777.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15215432..15215542 17..127 100 -> Plus
2L 15215614..15215670 128..186 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:30 Download gff for BO34777.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15215432..15215542 17..127 100 -> Plus
arm_2L 15215614..15215670 128..186 96   Plus

BO34777.pep Sequence

Translation from 16 to 202

> BO34777.pep
MPFSLFTTSIAVAGRPPKFKSFSAITLNRRDPSCAQMEFGAAKTTTTGWK
TRNGHHASFLDH

BO34777.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG43230-PA 56 CG43230-PA 1..56 1..56 300 100 Plus