BO34777.complete Sequence
202 bp assembled on 2013-10-29
GenBank Submission: KX794385
> BO34777.complete
GAAGTTATCAGTCGACATGCCTTTTAGTCTCTTCACTACCAGCATAGCTG
TAGCTGGTCGGCCTCCAAAGTTCAAGAGCTTTTCGGCAATAACTTTAAAT
AGAAGAGACCCATCTTGTGCCCAAATGGAATTCGGTGCGGCGAAAACCAC
GACGACAGGGTGGAAAACAAGAAACGGGCATCATGCAAGCTTTCTAGACC
AT
BO34777.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:32:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43230-RA | 171 | CG43230-PA | 1..168 | 17..184 | 840 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:32:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43230-RA | 799 | CG43230-RA | 141..309 | 16..184 | 845 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 15215431..15215543 | 16..128 | 565 | 100 | Plus |
2L | 23513712 | 2L | 15215613..15215670 | 127..184 | 290 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:32:15 has no hits.
BO34777.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:30 Download gff for
BO34777.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43230-RA | 142..309 | 17..186 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:25 Download gff for
BO34777.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43230-RA | 142..309 | 17..186 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:25 Download gff for
BO34777.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 15215432..15215542 | 17..127 | 100 | -> | Plus |
2L | 15215614..15215670 | 128..186 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:30 Download gff for
BO34777.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 15215432..15215542 | 17..127 | 100 | -> | Plus |
arm_2L | 15215614..15215670 | 128..186 | 96 | | Plus |
BO34777.pep Sequence
Translation from 16 to 202
> BO34777.pep
MPFSLFTTSIAVAGRPPKFKSFSAITLNRRDPSCAQMEFGAAKTTTTGWK
TRNGHHASFLDH
BO34777.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43230-PA | 56 | CG43230-PA | 1..56 | 1..56 | 300 | 100 | Plus |